DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and tfam

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001070857.1 Gene:tfam / 571106 ZFINID:ZDB-GENE-061013-552 Length:277 Species:Danio rerio


Alignment Length:62 Identity:14/62 - (22%)
Similarity:38/62 - (61%) Gaps:4/62 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 RRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPY----VEEAERLRV 273
            :||:.|:|.:.|..:..::.:||.:.:.|:.:.:.::|:.||.:.::|:    :|..|:.::
Zfish    48 KRPLTAYMTFVKDMQPTVSKQNPSIKSVDVMRKIAQQWKMLTTEQKQPFQVASLEAKEQYKL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 14/62 (23%)
PHA03273 305..>391 CDD:223031
tfamNP_001070857.1 HMG-box_SF 49..107 CDD:438789 14/57 (25%)
HMG-box_TFAM_rpt2 132..231 CDD:438803
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.