DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox6

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001116481.1 Gene:sox6 / 567154 ZFINID:ZDB-GENE-081120-6 Length:768 Species:Danio rerio


Alignment Length:533 Identity:124/533 - (23%)
Similarity:183/533 - (34%) Gaps:202/533 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YPHVSRT--------------PEYSHSTGSDYPEH----------GGYLTDGRLMHESNSDAGIY 62
            :||..||              |..|:..|.:||..          ...|...:|..       :|
Zfish   274 FPHDQRTLAAAAAAQQGFLFPPGMSYKPGDNYPVQFIPSTMAAAAASGLNPLQLQQ-------LY 331

  Fly    63 HVRQGSEHSSPSLHSP----------AIQSSGYENEHLNEAVLAAHSHS---------------- 101
            ..:..|...||....|          .|..||.:||..:...||.....                
Zfish   332 AAQLASMQVSPGAKMPPLPQPPNSAGQISPSGLKNEKRSSTPLAQVKEEGTQPLNLSARPKTAEP 396

  Fly   102 -HSPMPMVSSAYVGGGTASGSLINS-NIPL-LGGGGN-------SVLN----------------- 139
             .||.....|.:.|..::..||..| :||. :||.|.       |.||                 
Zfish   397 IKSPTSPTQSLFPGSKSSPNSLSKSGDIPSPIGGLGRGSSLDILSSLNSTALFGDQDAVMKAIQE 461

  Fly   140 ----------KFLSHPHAGM---------VGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCAPNC 185
                      :.|.|...||         :|....:.|...||          ||..|.      
Zfish   462 ARKMREQIQREQLQHHQQGMEVKLSALTSMGLNNCRTEKERSH----------YDNLGH------ 510

  Fly   186 GYLER--------HKPL----PADLKYRPGGTQSKSAK-----------ESRIRRPMNAFMVWAK 227
             :|.:        |:.:    |.|.:   ||..:..|:           |..|:|||||||||||
Zfish   511 -HLSKLGEDGKIGHRVIDLTRPEDFE---GGASTTEARVYREPRGRNSNEPHIKRPMNAFMVWAK 571

  Fly   228 IERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPR----- 287
            .||:|:....||:||:::||:||.:|:|:|.|:::||.||..||..||:.::|||||:||     
Zfish   572 DERRKILQAFPDMHNSNISKILGSRWKSMTNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTC 636

  Fly   288 ----------------RRKQSKLR--------------------AMQPGGKEQSESSPNPGTGGS 316
                            |.::.::|                    .:.||....:.::|:|.....
Zfish   637 IIDGKKLRISEYKQMMRSRRQEMRQFFTVGQQPQTQIPITTSAGVVYPGAITMATTTPSPHMTSD 701

  Fly   317 KSNPKLATPPLATASSSYTTPTDESTCNSTNQNHGQSTP----GGLYEQPLKPTYSPSSVDCYSN 377
            .|:        |:||...|.|..:||.| .....|...|    .|..|..:...:.......||:
Zfish   702 CSS--------ASASPEPTIPVIQSTFN-MKMEPGTMVPSDAVNGEDEMDMYEDFEDEPKSDYSS 757

  Fly   378 ADSTEQIESLAAN 390
            .:.|.  |.::||
Zfish   758 ENDTH--EPVSAN 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 39/70 (56%)
sox6NP_001116481.1 SOX-TCF_HMG-box 558..629 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.