DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox13

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001352418.1 Gene:sox13 / 555983 ZFINID:ZDB-GENE-100519-1 Length:597 Species:Danio rerio


Alignment Length:478 Identity:112/478 - (23%)
Similarity:177/478 - (37%) Gaps:182/478 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EHPHHLLTNYNSKKYPHVSRTPEYSHSTGSDYPEHGGYLTDGRLMHESNSDAGIYHVRQGSEH-- 70
            |:|..||.|      ||  .|| ...|:|:.|                         ||.:..  
Zfish   257 EYPMQLLPN------PH--STP-VKRSSGTVY-------------------------RQDTSQPL 287

  Fly    71 ---SSPSLHSP-----AIQSSGYENEHLNEAVLAAHSHSHSPMPMVSSAYVGGGTASGSLINSNI 127
               :.|...||     |...|||.:..|.::         .|...:|.:::|.|......|:...
Zfish   288 NLTAKPKTPSPQALELAHLQSGYRHRDLPQS---------PPRSALSLSFLGEGDVVTQAIHDAQ 343

  Fly   128 PLLGGGGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAA-------------SMWSYDYKGD 179
            .||.||.:|                 ||:..|  :::.:||:             ...|.|.:|.
Zfish   344 QLLRGGQSS-----------------TGRERD--NNTRLEASRDRMDDGHSRTNEDHHSSDSEGQ 389

  Fly   180 LCAPNCGYLERHKPLPADLKYRPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNAD 244
            :.....|..                .:|::.....|:|||||||||||.||:::....||:||:.
Zfish   390 MAISGVGSF----------------GESRTPSSGHIKRPMNAFMVWAKDERRRILQAFPDMHNSS 438

  Fly   245 LSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRP----------RRRKQSKLRAMQP 299
            :||:||.:|:|::.|:::||.||..||...|:..:|:|||:|          ||.:..:.:||..
Zfish   439 ISKILGSRWKSMSNQEKQPYYEEQARLSRQHLERYPDYKYKPRPKRTCIVEGRRLRVGEYKAMMK 503

  Fly   300 GGKEQSESSPNPGTGGSKSNPKLATPPLATASSSY-TTPTDESTCNSTNQNHGQSTPGGLYEQPL 363
            ..:::...|..|    |:|..:|..||   :...| |||...||.                  ||
Zfish   504 SRRQEQRVSYPP----SQSEQQLPYPP---SEGQYPTTPVSMSTL------------------PL 543

  Fly   364 KPTYSPSSVDCYSNADSTEQIESLAANCPPALLNESSPTGGGYDNSLLLKKLTKPSPSRAAKSRQ 428
            .                            ||||....|.|            .:|...|.:::|:
Zfish   544 H----------------------------PALLEHYLPRG------------LEPPQGRVSETRE 568

  Fly   429 -----EKLAKSEEKNKGSQSQGQ 446
                 :..::.||.:.|.:|:|:
Zfish   569 SARPRQPYSEGEESDAGERSEGE 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 35/70 (50%)
sox13NP_001352418.1 SOX-TCF_HMG-box 408..479 CDD:238684 35/70 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.