DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox13

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_012818604.1 Gene:sox13 / 549758 XenbaseID:XB-GENE-481889 Length:577 Species:Xenopus tropicalis


Alignment Length:350 Identity:88/350 - (25%)
Similarity:138/350 - (39%) Gaps:119/350 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LMHESNSDAGIYHVRQGSEHSSPSLHSPAIQSSGYENEHLNEAVLAAHSHSHSPMPMVSSAYVGG 115
            |:|.|.:...:...||  |.|.| |:..|..:....|..      ::..:..||:          
 Frog   248 LLHNSTTRGSVSAKRQ--ETSQP-LNLTAKPTDQVPNSR------SSPKYRMSPV---------- 293

  Fly   116 GTASGSLINS-------NIPLLGGGGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAASMWS 173
            |:..||.::|       |:||                  |.:|.|     |..:.:..||..:  
 Frog   294 GSQGGSSMDSASSPQKANLPL------------------GFLGEG-----DAITKAIQEACQL-- 333

  Fly   174 YDYKGDLCAPNCGYLERHKPLPADLKYRPGGTQSKSAKE-------------------------- 212
              ..|...:|     |.|:.     |||.....:...||                          
 Frog   334 --LHGQNTSP-----EHHQQ-----KYRKELLDTLPEKEVQDGASLQHTEESVLGCNMDIDGSRG 386

  Fly   213 SRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMT 277
            |.|:|||||||||||.||:|:....||:||:.:||:||.:|:|::..:::||.||..||...|:.
 Frog   387 SHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMSNAEKQPYYEEQARLSRQHLE 451

  Fly   278 EHPNYKYRPR----------RRKQSKLRAMQPGGKEQS------------ESSPNPGTGGSKS-N 319
            .:|:|||:||          |.:..:.:|:....::.:            :..|:|....|:| .
 Frog   452 RYPDYKYKPRPKRTCIVEGKRLRVGEYKALMKNRRQDTRQGYVITSIGALQCPPSPSGFSSQSLL 516

  Fly   320 PKLATPPLATASSSYTTPTDESTCN 344
            ..|:..|    ||.:..|.|   ||
 Frog   517 DNLSQLP----SSDHYNPQD---CN 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 35/70 (50%)
sox13XP_012818604.1 SOX-TCF_HMG-box 388..459 CDD:238684 35/70 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.