DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and cic

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster


Alignment Length:618 Identity:130/618 - (21%)
Similarity:205/618 - (33%) Gaps:179/618 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 GTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEA 268
            ||.:......:|||||||||:::|..||.:..::|:..|..:||:||:.|.:|.|:.:..|.|.|
  Fly  1221 GTAAGQPANKKIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQKAQYHELA 1285

  Fly   269 ERLRVIHMTEHPNYKYRPRRRKQSKLRAMQPGGKEQSESSPNPGTGGSKSNPKLATPPLATASSS 333
            ..::..|...||.:|:..:.|::|......||||    :|...|||.:|..       |.:...|
  Fly  1286 SSVKDAHFKLHPEWKWCSKDRRKSSTSTATPGGK----ASGAAGTGDAKQR-------LVSVDGS 1339

  Fly   334 YTTPTDESTCNSTNQNHGQSTPGGL-------YEQPLKPTYSPSSVDCY-SNADSTEQIESLAAN 390
                      :|...:...|||||.       ....|:....|.::|.| |..|......|:..|
  Fly  1340 ----------DSLEHDMCPSTPGGSGSCGGQGISSDLQGDIIPLTIDNYNSTCDEAPTTISMKGN 1394

  Fly   391 CPPALLNESSPTGGGYDNSLLLKKLTKPSPSRAAKSRQEKLAKSEE---KNKGSQSQGQSQQGIY 452
            ....|:....|:  ..|..:|:          ..:.:|::..|..:   :.:.:.|........|
  Fly  1395 GNGKLMKNELPS--DEDEQMLV----------VEEEQQQQTVKKIDLHCRERVNDSDMDDTPFDY 1447

  Fly   453 AATYPLAPTSVAVVAARGMYVTCNNRGLLDH------GHSVKGTFYPPVSVSEDDNSTSMRNSIS 511
            ....|.|                |.|...:|      |.::..   ||:|..|.:.:...:    
  Fly  1448 RKQQPEA----------------NQRSAEEHSTSGANGQAINA---PPLSGGEREITLKPK---- 1489

  Fly   512 ALQQHCNVVTSTPSSSGGTMPTSEMSSYTVSMADNCGNLRLSMNELSGNEYLPSANAY------- 569
            |::.|       |......:|.::||.||...:..        |.:....:.|:..|:       
  Fly  1490 AIKAH-------PVLESNMLPYTQMSIYTQYTSPK--------NPIGVTPFQPTGGAFKSMPISP 1539

  Fly   570 ---GMQYEDFLRYQSN----DMDYSTSAVEHKETTSDSASGQKCLKYPDTNQNYDDYEAEAYSNA 627
               |.:.||....|::    |:.....:.......|.||||...:..|..|..    ...|..|.
  Fly  1540 KGSGGKPEDAGSLQAHIKQEDIKQEPPSPYKLNNGSGSASGGGVVSAPPPNSG----SVGAIFNF 1600

  Fly   628 MLPATAASYYTQLPYP-------PTSLAAFPLQLAVPFQQTTSGAYGAQPIQSGYLHYGNYGGYE 685
            .:|...|....|..||       ||.|.| ..|..||          :.|...|..|..|.....
  Fly  1601 NVPTATALSQKQFHYPMHHPHRSPTDLRA-AHQACVP----------SSPAGMGLGHAANIATPP 1654

  Fly   686 GMAQSQPQNQAPVHHQ------------QASH-----------------------------SAPP 709
            ..|.:|.....|...:            |.||                             |.||
  Fly  1655 ASAPAQIMGGGPASQKMFFAMTHPYTLLQRSHQPGTPSLEHLQLDAFAPGGYTLRNHNGLSSLPP 1719

  Fly   710 SLSVPPNQTVTSNSAAISMQQHHHHHFGPAPGM 742
            .:|..|...:              |.:.|:.|:
  Fly  1720 PVSAQPTMLL--------------HGYPPSHGV 1738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 28/70 (40%)
cicNP_001262755.1 DUF4819 349..431 CDD:292708
SOX-TCF_HMG-box 1231..1302 CDD:238684 28/70 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I3058
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.