DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and LEF1

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_005263103.1 Gene:LEF1 / 51176 HGNCID:6551 Length:414 Species:Homo sapiens


Alignment Length:375 Identity:85/375 - (22%)
Similarity:141/375 - (37%) Gaps:113/375 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPSYD--HEHPHHLLTNYNSKKYPHVSRTPEYSHSTGSDYPEHGGYLTDGRLMHESNSDAGIYHV 64
            ||.:|  .|||       :..|:|...     .::.|..|..:.||:    :|...|:|.   ::
Human    81 EPYHDKAREHP-------DDGKHPDGG-----LYNKGPSYSSYSGYI----MMPNMNNDP---YM 126

  Fly    65 RQGSEHSSP-----SLHSPAIQSS----------GYENEHLNEAVLAAHSHS----------HSP 104
            ..||  .||     |...|.:|.|          .|.:||.:.....:|..|          |.|
Human   127 SNGS--LSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPP 189

  Fly   105 MPMVSSAY---VGGGTASGSLINSNIPLLGGGGNSV--------------------LNKFLSHPH 146
            .|.:.:.|   .||       :....|.||..|..|                    :::|..|  
Human   190 APDIPTFYPLSPGG-------VGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHH-- 245

  Fly   147 AGMVGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCAPNCGYLERHKPLPADLKY-RPGGTQSKSA 210
              |:.|..|.......|..|....:                .:.|....:||.: :|...|.|..
Human   246 --MIPGPPGPHTTGIPHPAIVTPQV----------------KQEHPHTDSDLMHVKPQHEQRKEQ 292

  Fly   211 KESR--IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRV 273
            :..|  |::|:||||::.|..|..:..|.....:|.::::||::|.:|:.:::..|.|.|.:.|.
Human   293 EPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQ 357

  Fly   274 IHMTEHPNYKYR-----PRRRKQSKLRAMQPGGKEQS-------ESSPNP 311
            :||..:|.:..|     .::||:.||:....|||..|       .::|.|
Human   358 LHMQLYPGWSARDNYGKKKKRKREKLQESASGGKRSSFPTCKAKAATPGP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 22/72 (31%)
LEF1XP_005263103.1 CTNNB1_binding 1..213 CDD:285538 36/159 (23%)
SOX-TCF_HMG-box 298..369 CDD:238684 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.