DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sox2

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001102651.1 Gene:Sox2 / 499593 RGDID:1565646 Length:319 Species:Rattus norvegicus


Alignment Length:273 Identity:84/273 - (30%)
Similarity:134/273 - (49%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEE 267
            ||.|..|  ..|::|||||||||::.:|:|:|.|||.:||:::||.||.:|:.|:..::||:::|
  Rat    33 GGNQKNS--PDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDE 95

  Fly   268 AERLRVIHMTEHPNYKYRPRRRKQSKLR---------AMQPGGKEQSESSPNPGTG-GSKSNPKL 322
            |:|||.:||.|||:|||||||:.::.::         .:.|||...: |....|.| |:..|.::
  Rat    96 AKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA-SGVGVGAGLGAGVNQRM 159

  Fly   323 ATPPLAT--ASSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPL---------------------- 363
            .:.....  ::.||:...::.   ...|:.|.:..|....||:                      
  Rat   160 DSYAHMNGWSNGSYSMMQEQL---GYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNG 221

  Fly   364 KPTYSPSSVDCYSNADST--------EQIESLAANCPPALLNES---SPTGGGYDN---SLLLKK 414
            .||||.|    ||...:.        ..::|.|::.||.:.:.|   :|...|...   |:.|..
  Rat   222 SPTYSMS----YSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG 282

  Fly   415 LTKPSPSRAAKSR 427
            ...|.|  ||.||
  Rat   283 AEVPEP--AAPSR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/70 (54%)
Sox2NP_001102651.1 SOX-TCF_HMG-box 42..113 CDD:238684 38/70 (54%)
SOXp 112..202 CDD:403523 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.