DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and hbp1

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001008149.2 Gene:hbp1 / 493511 XenbaseID:XB-GENE-950343 Length:541 Species:Xenopus tropicalis


Alignment Length:458 Identity:83/458 - (18%)
Similarity:130/458 - (28%) Gaps:198/458 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HLLTNYNSKKYPHVSRTPEYSHSTGSDYPEHGGYLTDGRLMHESNSDAGI--------------- 61
            ||.:..:.::|    ..|.:|.:| ||..|           :|.:.|.|:               
 Frog   104 HLDSGISHQEY----TVPSWSQNT-SDISE-----------NEYSCDTGMNWLTELANIATSPQS 152

  Fly    62 ------YHVRQGSEH---SSPSLHS-------PAIQSSGYENEHLNEAVLAAH----SHSHSPMP 106
                  ::.|....|   :|.||||       |....|.....|..|..:..|    |.|.|.:.
 Frog   153 PLMQCSFYNRSSPVHIIATSKSLHSYARPPPVPTESKSNVSRSHWREETMVRHERTNSESESGIF 217

  Fly   107 MVSS--------------------------------------------------------AYVGG 115
            .:||                                                        :|.|.
 Frog   218 CMSSFSDDDDLGWCHSWPQTVWHCFLKGTRLCFHKGRKKQWQDVEEFAKSTRCRNERGIDSYKGY 282

  Fly   116 GTASGSLINSNIPLLGGGGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAASM-WSYDYK-- 177
            |:....|::....:  ..|.|||.....   .|...||...:| |....|....:. ||..|.  
 Frog   283 GSDGLKLVSYEECV--SYGESVLQLTFD---PGTTDGGLLTVE-CKLDHPFYVKNKGWSSFYPSL 341

  Fly   178 --------------GDLCAP----------NCGYLERHK-----PLPADLKY------------- 200
                          ||:|.|          :.|..:..|     |:.:...|             
 Frog   342 TVVQHGIPCCEIHVGDVCLPPGHPDAINFDDSGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASS 406

  Fly   201 -----RPGGTQSKSAKE-----------------------------------SRIRRPMNAFMVW 225
                 .|...:|:..|:                                   ::.:|||||||::
 Frog   407 NGRASSPESERSEYCKDYASPRSSQTSCSSLCNKTGRNHTSGTANSVPVTSPNKCKRPMNAFMLF 471

  Fly   226 AKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRK 290
            ||..|.:.....|...|..:|.:||.:|:.:..::||.|..||:.|.......:|:...|.|...
 Frog   472 AKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRIYTIEAKALAEEQKRLNPDCWKRKRTNS 536

  Fly   291 QSK 293
            .|:
 Frog   537 GSQ 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 23/70 (33%)
hbp1NP_001008149.2 AXH 242..362 CDD:369920 20/125 (16%)
SOX-TCF_HMG-box 460..531 CDD:238684 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.