DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox3

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001007502.1 Gene:sox3 / 493228 XenbaseID:XB-GENE-484815 Length:307 Species:Xenopus tropicalis


Alignment Length:336 Identity:90/336 - (26%)
Similarity:145/336 - (43%) Gaps:120/336 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 MEDCTSHSPIEAASMWSYDYKGDLCAPNCGYLERHKPLPADLKYRPGGTQSKS-AKESRIRRPMN 220
            |.|....||::.::           |||.|        |.    .|||..:.| ..:.|::||||
 Frog     4 MLDTDLKSPVQQSN-----------APNGG--------PG----TPGGKGNASIPDQERVKRPMN 45

  Fly   221 AFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYR 285
            |||||::.:|:|:|.|||.:||:::||.||..|:.|:..::||:::||:|||.:||.|:|:||||
 Frog    46 AFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLSDSEKRPFIDEAKRLRAVHMKEYPDYKYR 110

  Fly   286 PRRRKQSKLRAMQPGGKEQSESSPN----PGTGGSKSNPKLATPPLATA---------------- 330
            |||:.::.|       |:...|.|.    ||..           |:|::                
 Frog   111 PRRKTKTLL-------KKDKYSLPGNLLAPGVS-----------PVASSVGVGQRIDTYAHMNGW 157

  Fly   331 -SSSYTTPTDESTCNSTNQNHGQSTP-----------GGLYEQPL---KPTYSPSSVDCYSNADS 380
             :.:|:...|:.   ..:|:.|.::|           |||...|:   ..||..::...||.:.:
 Frog   158 TNGAYSLMQDQL---GYSQHPGMNSPQMQQIQHRYDMGGLQYSPMMSSAQTYMNAAASTYSMSPA 219

  Fly   381 TEQ--------------IESLAANCPPALLNESS---------------PTGGGYDNSLLLKKLT 416
            ..|              ::|..::.|||:.:.:.               |.||  |.|       
 Frog   220 YNQQSSTVMSLGSMGSVVKSEPSSPPPAITSHTQRACLGDLRDMISMYLPPGG--DAS------- 275

  Fly   417 KPSPSRAAKSR 427
              .||....||
 Frog   276 --DPSSLQSSR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 37/70 (53%)
sox3NP_001007502.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 14/59 (24%)
SOX-TCF_HMG-box 39..110 CDD:238684 37/70 (53%)
SOXp 109..189 CDD:372055 18/100 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.