DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sox102F

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster


Alignment Length:431 Identity:117/431 - (27%)
Similarity:183/431 - (42%) Gaps:101/431 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PSYDHEHPHHLLTNYNSKKYPHVSRTPEYSHSTGSDYPEHGGYLTDGRLMHESNSDAGIYHVRQG 67
            |:|::. |:.:|:      |.| :..||..|...:|..::........|...|.|:|      |.
  Fly   232 PTYENP-PYEILS------YSH-NTPPESPHGRTADCSKNFSPSPTDNLSIASVSEA------QD 282

  Fly    68 SEHSSP-SLHSPAIQSSGYENEHLNEAVLAAHSHSHSPMPMVSSAYVGGGTASGSLINSNIPLLG 131
            ||..:| :|..|....|...|..      :...|..:..|:|||..:.............:|||.
  Fly   283 SEMDAPLNLSKPKGSPSSSPNSS------SQRDHCENLTPVVSSPPLSWHQGQPHYAEIELPLLK 341

  Fly   132 GGGNSVLNKFLSHPHAGMVGGGT-------GQMEDCTSHSPIEAASMWSYDYKGDLCAPNCGYLE 189
            ..|. |.|.      |....||:       ..:..|.::|...||.        |..:.|.|.| 
  Fly   342 SHGR-VWNS------AVACSGGSRATRVSRDSVNSCGTNSERSAAL--------DPESLNSGQL- 390

  Fly   190 RHKPLPADLKYRP---------GGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADL 245
              .|:||....:|         ||.......:..|:|||||||||||.||:|:....||:||:::
  Fly   391 --GPVPASPSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNI 453

  Fly   246 SKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPR---------------------RR 289
            ||:||.:|::::..|::||.||..||..:||.:||:|:||||                     |.
  Fly   454 SKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRN 518

  Fly   290 KQSKLRAM--QPGGKEQSESS------PNPGTGGSKSNPKLATPPLATASSSYTTPTDESTCNST 346
            :::::|.:  :.||......|      |. |:||  ||.::|   :|.|::.|......|:..||
  Fly   519 RRAEMRQLWCRTGGVSGGSGSLCADACPK-GSGG--SNSQVA---VAAAAAVYHLQDMASSAAST 577

  Fly   347 NQNH--GQSTPGGLYEQPLKPTYSPSSVDCYSNADSTEQIE 385
            ...|  |.:.|...:..|  .:.|||..       |::::|
  Fly   578 AHGHDCGHTPPQQFFYPP--ESLSPSGF-------SSDEVE 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 36/70 (51%)
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 36/70 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451308
Domainoid 1 1.000 46 1.000 Domainoid score I3058
eggNOG 1 0.900 - - E1_KOG0527
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.