DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox1a

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001002483.1 Gene:sox1a / 436756 ZFINID:ZDB-GENE-040718-186 Length:336 Species:Danio rerio


Alignment Length:408 Identity:109/408 - (26%)
Similarity:166/408 - (40%) Gaps:114/408 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 MWSYDYKGDLCAPNCGYLERHKPLPADLKYRPGGTQSKS---AKESRIRRPMNAFMVWAKIERKK 232
            |:|...:.||          |.|.| .....||.|...|   |.:.|::|||||||||::.:|:|
Zfish     1 MYSMMMETDL----------HSPGP-QTNTNPGQTGPNSGSKANQDRVKRPMNAFMVWSRGQRRK 54

  Fly   233 LADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLR-- 295
            :|.|||.:||:::||.||.:|:.::..::||:::||:|||.:||.|||:|||||||:.::.|:  
Zfish    55 MAQENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKTKTLLKKD 119

  Fly   296 ----------------AMQPGGKEQSESSPNPGTGGSKSNPKLATPPLATASSSYTTPTDESTCN 344
                            .|.|.|..|...||    ||                             
Zfish   120 KYSLAGGLLGGAGGGVGMSPAGVGQRLESP----GG----------------------------- 151

  Fly   345 STNQNHGQSTPGGLYEQPLKPTYSPSSVDCYSNADSTEQIESLAANCPPALLNESS------PTG 403
                 ||.|...|.           :.::.::|...:.|:.:.||  ..|::.|:.      |..
Zfish   152 -----HGSSASAGY-----------AHMNGWANGTYSGQVAAAAA--AAAMMQEAQLAYSQHPGS 198

  Fly   404 GGYDNSLLLKKLTKPSPSRAAKSRQEKLAKSEEKNKGSQS-QGQSQQGIYAATYPL-APTSVAVV 466
            |.:.:.........|.|..    |.:..|........||| ...|..|....:|.. ..:|||..
Zfish   199 GSHHHHAHHHHPHNPQPMH----RYDMTALQYSPISNSQSYMSASPSGYGGISYTQHQNSSVATP 259

  Fly   467 AARGMY-------------VTCNNRGLLDHGHSVKGTFYPPVSVSEDDNSTSMRNSISALQQHCN 518
            ||.|..             ||.::||..........:.|.|...|.|   .|:::.:.||.||  
Zfish   260 AAIGTLSSLVKSEPNISPPVTTHSRGPCPGDLREMISMYLPTGESGD---PSVQSRLHALPQH-- 319

  Fly   519 VVTSTPSSSGGTMPTSEM 536
             ..||.:...||:|.:.:
Zfish   320 -YQSTTAGVNGTVPLTHI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 37/70 (53%)
sox1aNP_001002483.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 13/48 (27%)
SOX-TCF_HMG-box 36..107 CDD:238684 37/70 (53%)
SOXp 106..>194 CDD:289133 24/138 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..216 3/22 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.