DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and tHMG2

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster


Alignment Length:184 Identity:37/184 - (20%)
Similarity:67/184 - (36%) Gaps:72/184 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SRIRRPMNAFMVWA-KIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHM 276
            :|.::||:|||:|. ...||.:..|:||....::|...|:.||::..:.:..:.|.|.:.    |
  Fly     7 ARPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKA----M 67

  Fly   277 TEHPNYKYRPRRRKQSKLRAMQPGGKEQSESSPNPGTGGSKSNPKLATPPLATASSSYTTPTDES 341
            .|:        :.|..|..|.:   :.|:||.|:                               
  Fly    68 AEY--------KEKLEKWNAFK---EHQTESFPH------------------------------- 90

  Fly   342 TCNSTNQNHGQSTPGGLYEQPLKPTYSPS----SVDCYSNADSTEQIESLAANC 391
                            :||.||...:|.:    ::..|.:.|     |::|..|
  Fly    91 ----------------IYEAPLSSRFSKTNQRPTLFVYDSKD-----EAMAPIC 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 20/75 (27%)
PHA03273 305..>391 CDD:223031 12/89 (13%)
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 21/78 (27%)

Return to query results.
Submit another query.