DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and tHMG1

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster


Alignment Length:57 Identity:19/57 - (33%)
Similarity:34/57 - (59%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SRIRRPMNAFMVWA-KIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEA 268
            :|.::||:|||:|. ...||.:..|:||....::|...|:.||::..:|:..:.|.|
  Fly     6 ARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESA 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 19/56 (34%)
PHA03273 305..>391 CDD:223031
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.