DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and TFAM

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster


Alignment Length:149 Identity:31/149 - (20%)
Similarity:59/149 - (39%) Gaps:33/149 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 HKPL-------PADLKYRPGGTQSKSAKES-----RIRRPMNAFMVWAKIERKKLADENPDLHNA 243
            |:||       .|.:...| ...||:.:|.     |.::|:..:..:.:.:|.||...||.:...
  Fly    43 HRPLTPPRPLAAASISNTP-AVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPKLKAANPQITTV 106

  Fly   244 DLSKMLGKKWRSLTPQ-----------DRRPYVEEAERLRVIHMTEHPNYKYR--------PRRR 289
            ::.:.|.|.|.....|           |::.||||..:.... :||....:.:        .:.|
  Fly   107 EVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDAT-LTEEQRAEIKQLKQDLVDAKER 170

  Fly   290 KQSKLRAMQPGGKEQSESS 308
            :|.:.|..:.|..::..|:
  Fly   171 RQLRKRVKELGRPKKPASA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 18/93 (19%)
PHA03273 305..>391 CDD:223031 1/4 (25%)
TFAMNP_732527.1 HMG-box_SF 78..138 CDD:469606 11/59 (19%)
HMG-box_SF 168..263 CDD:469606 5/22 (23%)

Return to query results.
Submit another query.