DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox2

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_998869.1 Gene:sox2 / 407873 XenbaseID:XB-GENE-484553 Length:311 Species:Xenopus tropicalis


Alignment Length:321 Identity:96/321 - (29%)
Similarity:153/321 - (47%) Gaps:74/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KPLPADLKYRPGGTQSKSAKES-----RIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGK 251
            || ||..:...|.:.|.|..:|     |::|||||||||::.:|:|:|.|||.:||:::||.||.
 Frog    10 KP-PAPQQASGGNSNSGSNNQSKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGA 73

  Fly   252 KWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQ---PGGKEQSESSP-NPG 312
            :|:.|:..::||:::||:|||.:||.|||:|||||||:.::.::..:   |||.....::| ..|
 Frog    74 EWKLLSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGANPMTSG 138

  Fly   313 TG---GSKSNPKLAT------------------------PPLATASSSYTTPT---DESTCNSTN 347
            .|   |:..|.::.|                        |.|:..::....|.   |.|.....:
 Frog   139 VGASLGAGVNQRMDTYAHMNGWTNGGYGMMQEQLGYPQHPGLSAHNAPQMQPMHRYDVSALQYNS 203

  Fly   348 QNHGQSTPGGLYEQPLKPTYSPSSVDCYSNADST--------EQIESLAANCPPALLNES---SP 401
            .:..|:...|      .||||.|    ||...:.        ..::|.:::.||.:.:.|   :|
 Frog   204 MSSSQTYMNG------SPTYSMS----YSQQGAPGMSLGSMGSVVKSESSSSPPVVTSSSHSRAP 258

  Fly   402 TGGGYDN---SLLLKKLTKPSPSRAAKSRQEKLAKSEEKNKGSQSQGQSQQGIYAATYPLA 459
            ...|...   |:.|.....|.|  ||:||   |..|:.....|.: |.:..|    |.||:
 Frog   259 CQAGDLRDMISMYLPGAEVPEP--AAQSR---LHMSQHYQSASVA-GTAING----TLPLS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/70 (54%)
sox2NP_998869.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 9/30 (30%)
SOX-TCF_HMG-box 36..107 CDD:238684 38/70 (54%)
SOXp 106..194 CDD:372055 17/87 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..259 4/26 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.