DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox21b

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001009888.1 Gene:sox21b / 406246 ZFINID:ZDB-GENE-040429-1 Length:245 Species:Danio rerio


Alignment Length:193 Identity:61/193 - (31%)
Similarity:99/193 - (51%) Gaps:51/193 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEH 279
            ::|||||||||::.:|:|:|.|||.:||:::||.||.:|:.||..::||:::||:|||.:||.||
Zfish     8 VKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMKEH 72

  Fly   280 PNYKYRPRRRKQSKLR----------------AMQPGG------KEQSESSPNPGTGGSKS---- 318
            |:|||||||:.::.::                |::.||      .|...|:|:.....:.:    
Zfish    73 PDYKYRPRRKPKTLMKKDKFAFPVAYNLGEHEALKVGGLPAGALTESLMSNPDKAAAAAAAAAAR 137

  Fly   319 ---NPKLATPP------------LATASSSYTTPTDESTC----------NSTNQNHGQSTPG 356
               ||.::..|            |:..|.||.:|....|.          .:....|...:||
Zfish   138 VFFNPSMSANPYSFFDLGSKMTELSPPSFSYASPLGYPTAATAFSGAVGGGAHTHTHSHPSPG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/69 (55%)
sox21bNP_001009888.1 SOX-TCF_HMG-box 7..78 CDD:238684 38/69 (55%)
SOXp 77..>95 CDD:289133 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.