DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox4a

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_998287.1 Gene:sox4a / 336346 ZFINID:ZDB-GENE-030131-8290 Length:363 Species:Danio rerio


Alignment Length:269 Identity:85/269 - (31%)
Similarity:139/269 - (51%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LPADLKYRPGGTQSKSAK---------ESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKML 249
            |..|....||...|...|         ...|:|||||||||::|||:|:.:::||:|||::||.|
Zfish    34 LDMDASPTPGSPNSAGDKMDIAWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRL 98

  Fly   250 GKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQPGGK-EQSESSPNPGT 313
            ||:|:.|...|:.|::.||||||:.||.::|:||||||::.:|.  :.:.|.| |:..:||...:
Zfish    99 GKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSS--SGKTGEKAERVSASPGAKS 161

  Fly   314 GGSKSNPKLATPPLATAS---SSYTTPTDESTCNSTNQNHGQSTPGGLYEQPLKPTY-------- 367
            ...||:..|:.....:.:   :|::.|.|.   ::..::...|....:.|:|.|..:        
Zfish   162 ASKKSSKTLSRTHRKSTTLELTSHSVPADH---HALYKSRSVSAAKQIPEKPAKRGHVYGGCSTD 223

  Fly   368 -SPSSVDCYSNADSTEQIESLAANCPPALLNESSPTGGGYDNSLLLK-KLTK-PSPS-RAAKSRQ 428
             ||.||    ...::..:.|.|.:..|..|.|.....|..|.....: |.|: |||: .|:.|..
Zfish   224 SSPPSV----AVPASPTLSSSAESSDPLSLYEDGLASGKEDAEPAARFKYTRAPSPTPSASHSYS 284

  Fly   429 EKLAKSEEK 437
            .:.:.|:|:
Zfish   285 SQSSSSDEE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 39/70 (56%)
sox4aNP_998287.1 SOX-TCF_HMG-box 63..134 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.