DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and HMGB2

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_002120.1 Gene:HMGB2 / 3148 HGNCID:5000 Length:209 Species:Homo sapiens


Alignment Length:123 Identity:34/123 - (27%)
Similarity:56/123 - (45%) Gaps:18/123 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 YRP--GGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRR 262
            |.|  |..:.|....:..:||.:||.::....|.|:..|:|.|...|.:|.||:.|...:.:|::
Human    78 YVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQ 142

  Fly   263 PYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQPGGK-EQSESSPNPGTGGSKSN 319
            ||.::|.:|:         .||      :..:.|.:..|| |..:..|...||..|.|
Human   143 PYEQKAAKLK---------EKY------EKDIAAYRAKGKSEAGKKGPGRPTGSKKKN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 21/74 (28%)
PHA03273 305..>391 CDD:223031 5/15 (33%)
HMGB2NP_002120.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..150 22/71 (31%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 22/84 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..209 8/24 (33%)
Required for chemotactic activity. /evidence=ECO:0000269|PubMed:19811285 165..180 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.