DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and HMGB1

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_002119.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens


Alignment Length:111 Identity:31/111 - (27%)
Similarity:58/111 - (52%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 YRP--GGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRR 262
            |.|  |.|:.|....:..:||.:||.::....|.|:..|:|.|...|::|.||:.|.:....|::
Human    78 YIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQ 142

  Fly   263 PYVEEAERLRVIHMTEHPNY--KYRPRRRKQSKLRAMQPGGKEQSE 306
            ||.::|.:|:..:..:...|  |.:|...|:..::|.:...|::.|
Human   143 PYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 22/76 (29%)
PHA03273 305..>391 CDD:223031 1/2 (50%)
HMGB1NP_002119.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 1..97 5/18 (28%)
LPS binding (delipidated). /evidence=ECO:0000269|PubMed:21660935 3..15
HMG-box_HMGB_rpt1 8..76 CDD:438794
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 5/16 (31%)
LPS binding (Lipid A). /evidence=ECO:0000269|PubMed:21660935 80..96 4/15 (27%)
Cytokine-stimulating activity. /evidence=ECO:0000269|PubMed:12765338 89..108 4/18 (22%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 19/69 (28%)
Binding to AGER/RAGE. /evidence=ECO:0000250|UniProtKB:P63159 150..183 6/32 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..215 7/28 (25%)
Nuclear localization signal (NLS) 2. /evidence=ECO:0000250|UniProtKB:P63159 178..184 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.