DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sox17

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001101372.1 Gene:Sox17 / 312936 RGDID:1305371 Length:423 Species:Rattus norvegicus


Alignment Length:375 Identity:124/375 - (33%)
Similarity:151/375 - (40%) Gaps:109/375 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LSHPHAGMVGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCAPNCGYLERHKPLPADLKYR----- 201
            :|.|.||.......|..   |..|...|.:          .| |.:.|....| .|:|.:     
  Rat     1 MSSPDAGYASDDQSQPR---SAQPAVMAGL----------GP-CPWAESLSSL-GDVKVKGEVVA 50

  Fly   202 ----PGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRR 262
                |.||.|::..||||||||||||||||.|||:||.:|||||||:|||||||.|::||..::|
  Rat    51 SSGAPAGTSSRAKAESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKR 115

  Fly   263 PYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQPGGKEQSESSPNPGTGGSK---------- 317
            |:|||||||||.||.:|||||||||||||.|......||...:.:.|..|..|.:          
  Rat   116 PFVEEAERLRVQHMQDHPNYKYRPRRRKQVKRMKRVEGGFLHALAEPQAGALGPEGGRVAMDGLG 180

  Fly   318 ---------SNPKLATPPL-----------ATASSSYTTPTDESTCNSTNQNHGQSTPGGLYEQP 362
                     :.|.|.:|.:           |.|...|..||                        
  Rat   181 LPFPEPGYPAGPPLMSPHMGAHYRDCQGLGAPALDGYPLPT------------------------ 221

  Fly   363 LKPTYSPSSVDCYSNADSTEQIESLAANCPPALLNESSPTGGGYDNSLLLKKLTKPSPSRAAKSR 427
              |..||        .|..||..:..|    |.|....|..|.|..:.:........|| |...|
  Rat   222 --PDTSP--------LDGVEQDPAFFA----APLPGDCPAAGAYTYAQVSDYAVPAEPS-AGPMR 271

  Fly   428 QEKLAKSEEKNKGSQSQGQSQQGIYAATYPL-----APTSVAVVAARGMY 472
                       .|....|.:..||.|....|     |..|.|..|.||.:
  Rat   272 -----------VGPDPSGSAMPGILAPPSALHLYYGAMGSPAASAGRGFH 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 54/70 (77%)
Sox17NP_001101372.1 SOX-TCF_HMG-box 67..138 CDD:238684 54/70 (77%)
Sox17_18_mid 203..253 CDD:403331 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5807
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm44833
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.