DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and lef1

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_571501.1 Gene:lef1 / 30701 ZFINID:ZDB-GENE-990714-26 Length:365 Species:Danio rerio


Alignment Length:346 Identity:78/346 - (22%)
Similarity:128/346 - (36%) Gaps:103/346 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SYDHEHPHHLLTNYNSKKYPHVSRTPEYSHSTGSDYPEHGGYLTDGRLMHESNSDAGIYHVRQGS 68
            ||..:|..|          |...:..:. :|.|..||.:.||:    :|...|::.   ::..| 
Zfish    80 SYHEKHRDH----------PDDGKLQDL-YSKGHPYPSYPGYI----MMTNMNNEP---YMNNG- 125

  Fly    69 EHSSPSLHSPAIQSSGYENEHLNEAVLAAHSHSHSPM-PMV--SSAYVGGGTASGSLINSNIPLL 130
                 ||..|..::|       |:..:...||:..|: |::  |..:...|..||.......|..
Zfish   126 -----SLSPPIPRTS-------NKVPVVQPSHAVHPLTPLITYSDEHFAPGPHSGHHPQDVNPKQ 178

  Fly   131 GG-----GGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCAPNCGYLER 190
            .|     .|..:.|.:...|      ||.|||                        .|..|:...
Zfish   179 AGMPRHHPGPDIPNFYPLSP------GGVGQM------------------------TPPLGWFSH 213

  Fly   191 HK------------PLPA------------DLKY-RPGGTQSKSAKESR--IRRPMNAFMVWAKI 228
            |.            |.||            ||.: :|...|.|..:..|  |::|:||||::.|.
Zfish   214 HMVPGPPGPHATGIPHPAIVNPQVKQEHDTDLMHMKPQHEQRKEQEPKRPHIKKPLNAFMLYMKE 278

  Fly   229 ERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSK 293
            .|..:..|.....:|.::::||::|.:|:.:::..|.|.|.:.|.:||..:|.:..|....|:.|
Zfish   279 MRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKK 343

  Fly   294 LRAMQPGGKEQSESSPNPGTG 314
                   .|.:....|..|||
Zfish   344 -------RKREKIQEPASGTG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 22/72 (31%)
lef1NP_571501.1 CTNNB1_binding 1..210 CDD:285538 38/190 (20%)
SOX-TCF_HMG-box 264..335 CDD:238684 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.