DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and tcf7l1a

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_571344.1 Gene:tcf7l1a / 30523 ZFINID:ZDB-GENE-980605-30 Length:560 Species:Danio rerio


Alignment Length:462 Identity:97/462 - (20%)
Similarity:157/462 - (33%) Gaps:155/462 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EHPHHL-----LTNYNSKKY-----------------------PHVSR-TPEYSHSTGS--DYPE 41
            :||||:     |..|:::.:                       ||.|. :|.|..|.|:  ..|.
Zfish   165 QHPHHVHPLTPLITYSNEHFSPGTPPSHLSPEILDPKTGIPRTPHPSELSPYYPLSPGAVGQIPH 229

  Fly    42 HGGYLTDGRLMHESNSDAGIYHVRQGSEHSSPSLHSPAIQSSGYENEHLNEAVLAAHSHSHSPMP 106
            ..|:|...:..|..:...|      |..|..|:|...|..||      |..:..:.|...|.|..
Zfish   230 PLGWLVPQQGQHMYSIPPG------GFRHPYPALAMNASMSS------LVSSRFSPHMVPHPPHG 282

  Fly   107 MVSSAYVGGGTASGSLINSNIPLLGGGGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAASM 171
            :..:..                                ||..:|.....|  :....||      
Zfish   283 LHQTGI--------------------------------PHPAIVSPAIKQ--EPNGESP------ 307

  Fly   172 WSYDYKGDLCAPNCGYLERHKPLPADLKYRPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADE 236
             |....|....|                     .:.:..|:..|::|:||||::.|..|.|:..|
Zfish   308 -SNSTHGKPSVP---------------------VKKEEEKKPHIKKPLNAFMLYMKEMRAKVVAE 350

  Fly   237 NPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPR--RRKQSKLRAMQP 299
            .....:|.::::||::|.||:.:::..|.|.|.:.|.:|...:|.:..|..  :||:.| |..:.
Zfish   351 CTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPGWSARDNYGKRKKRK-RDCKS 414

  Fly   300 GGKEQSESSPNPGTGGSKSNPKLATPPLATASSSYTTPTDESTCNSTNQNHGQ-----STPGGLY 359
            ....:|..||.|        .|...|.|::          |..|:|...:||.     :||....
Zfish   415 DSPSESNFSPQP--------KKQCVPYLSS----------EKMCDSPTSSHGSMLDSPATPSAAL 461

  Fly   360 EQPLKPTYSPSSVDCYSNADSTEQIESLAANCPP-----------ALLNESSPTGGGYDNSLLLK 413
            ..|..|.           |..:||.:.|:....|           .|..:||.:|.|  :|:.|.
Zfish   462 ASPAAPA-----------ATHSEQAQPLSLTTKPEGRAHHNHPHFPLPGKSSGSGSG--SSMALH 513

  Fly   414 KLTKPSP 420
            .|::|.|
Zfish   514 SLSRPIP 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 22/70 (31%)
tcf7l1aNP_571344.1 CTNNB1_binding 1..233 CDD:285538 14/67 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..328 7/60 (12%)
SOX-TCF_HMG-box 328..399 CDD:238684 22/70 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 395..513 32/149 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.