DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and tcf7l2

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_571334.1 Gene:tcf7l2 / 30510 ZFINID:ZDB-GENE-991110-8 Length:477 Species:Danio rerio


Alignment Length:351 Identity:77/351 - (21%)
Similarity:136/351 - (38%) Gaps:102/351 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EHPHHL-----LTNYNSKKY------PHVSRTPEYSHSTGSDYPEHGGYL---------TDGRLM 52
            :||||:     |..|:::.:      ||:.  .:....||...|.|...:         |.|::.
Zfish   169 QHPHHVHPLTPLITYSNEHFTPGNPPPHLQ--GDVDPKTGIPRPPHPPDISPYYPLSPGTVGQIP 231

  Fly    53 HESNSDAGIYHVRQGSEHSSPSLHSPAIQSSGYENEHLNEAVLAAHSHSHSPMPMVSSAYVGGGT 117
            |...     :.|.|..:...|      |.:.|:.:                |.|...:.    ..
Zfish   232 HPLG-----WLVPQQGQPVYP------ITTGGFRH----------------PYPTALTV----NA 265

  Fly   118 ASGSLINSNIPLLGGGGNSVLNKFLSH----PHAGMVGGGTGQMEDCTSHSPIEAASMWSYDYKG 178
            :..||::|..|     .:.|......|    ||..:|   |..::..:|||.|           |
Zfish   266 SMSSLLSSRFP-----PHMVPPHHSLHTTGIPHPAIV---TPNVKQESSHSDI-----------G 311

  Fly   179 DLCAPNCGYLERHKPLPADLKYRPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNA 243
            .|.:.               |::....:.:..|:..|::|:||||::.|..|.|:..|.....:|
Zfish   312 SLNSS---------------KHQDAKKEEEKKKQPHIKKPLNAFMLYMKEMRAKVVAECTLKESA 361

  Fly   244 DLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPR-RRKQSKLRAMQPG-GKEQSE 306
            .::::||::|.:|:.:::..|.|.|.:.|.:||..:|.:..|.. .:|:.:.|..|.| |.|..|
Zfish   362 AINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKQAGEGNEHRE 426

  Fly   307 SSPNPGTGGSKSNPKLATPPLATASS 332
            ..|         ||.|:.||:...|:
Zfish   427 YFP---------NPCLSLPPITDLSA 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 22/70 (31%)
tcf7l2NP_571334.1 CTNNB1_binding 17..236 CDD:285538 15/73 (21%)
SOX-TCF_HMG-box 332..403 CDD:238684 22/70 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.