DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox19a

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_570983.2 Gene:sox19a / 30038 ZFINID:ZDB-GENE-980526-102 Length:297 Species:Danio rerio


Alignment Length:259 Identity:77/259 - (29%)
Similarity:121/259 - (46%) Gaps:57/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GGTQSKSAKES-------------RIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWR 254
            ||....|||.:             :::|||||||||::.:|:|:|.|||.:||:::||.||.:|:
Zfish    28 GGVTHGSAKPAVNSQQQQSSDPMDKVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWK 92

  Fly   255 SLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQPGGK--------------EQS 305
            .||..::||:::||:|||.:||.|:|:|||:|||:.:..|:...|..|              :.|
Zfish    93 LLTDAEKRPFIDEAKRLRALHMKEYPDYKYKPRRKTKPVLKKDNPAAKYPLSAGNLLAAAAAQGS 157

  Fly   306 ESSP---NPGTGGSKSNPKLATPPLATA--------------SSSYTTPTDESTCNSTNQNHGQS 353
            ..||   :.|.|.:...|.:.|..|..:              |:..|..|..:..||.|.....|
Zfish   158 GGSPRMDSYGWGHTGGYPGMQTDALGYSQQLHRYDLSALQYPSAMATAQTYMNGANSYNPMSYSS 222

  Fly   354 TPGGLYEQP------LKP---TYSPSSVDCYSNADSTEQIESLAANCPPALLNESSPTGGGYDN 408
            ||    :||      :||   ::||:....:........:..:.:...|......|....||.|
Zfish   223 TP----QQPSPVMSMVKPEQVSHSPTGAHSHQRGPLQGDLRDMISMYIPGGDTTDSGAQRGYSN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 37/70 (53%)
sox19aNP_570983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 5/23 (22%)
SOX-TCF_HMG-box 52..123 CDD:238684 37/70 (53%)
SOXp 122..>187 CDD:289133 15/64 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..255 9/39 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.