DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sox7

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001099515.1 Gene:Sox7 / 290317 RGDID:1310038 Length:383 Species:Rattus norvegicus


Alignment Length:379 Identity:116/379 - (30%)
Similarity:164/379 - (43%) Gaps:110/379 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 RPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYV 265
            ||.|.:   ..||||||||||||||||.|||:||.:|||||||:|||||||.|::||...:||||
  Rat    34 RPSGDK---GSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYV 95

  Fly   266 EEAERLRVIHMTEHPNYKYRPRRRKQSK--LRAMQPG------------------------GKEQ 304
            :||||||:.||.::|||||||||:||.|  .:.:.||                        |:::
  Rat    96 DEAERLRLQHMQDYPNYKYRPRRKKQGKRLCKRVDPGFLLSSLSRDQNTLPEKNSIGRGPLGEKE 160

  Fly   305 SESSPNPGT-----------GGSKSNPKLATPPLATASSSYTTPTD----EST--CNSTNQNHGQ 352
            ......||.           |.:.:...:.|.|....:....:|.|    |.|  .:|..:.||.
  Rat   161 DRGEYAPGATLPGLHSCYREGAAAAPGSVDTYPYGLPTPPEMSPLDALEPEQTFFSSSCQEEHGH 225

  Fly   353 -----STPGGLYEQPLKPTYSPSSVDCYSNADSTEQIESLAANCPPALLNESS-----PTGGGYD 407
                 ..||    .|..|.::||.:.|      :..:.|||....|.:...||     |:...|.
  Rat   226 PHHLPHLPG----PPYSPEFTPSPLHC------SHPLGSLALGQSPGVSMMSSVPGCPPSPAYYS 280

  Fly   408 NSLL----------LKKLTKPSPSRAAKSRQEKLAKSE-----EKNKGSQ-----SQGQSQQGIY 452
            ::..          |.:|: |.|........::|::.|     ::|:..|     ....|..|:.
  Rat   281 HATYHPLHPNLQAHLGQLS-PPPEHPGFDTLDQLSQVELLGDMDRNEFDQYLNTPGHPDSASGVG 344

  Fly   453 AAT--------YPLAPTSVAVVAARGMYVTCNNRGLLDHGHSVKGTFYPPVSVS 498
            ..|        .|..||..::::.           |.|    ...|:|...|||
  Rat   345 TLTGHAPLSQGTPTGPTETSLISV-----------LAD----ATATYYNSYSVS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 52/70 (74%)
Sox7NP_001099515.1 SOX-TCF_HMG-box 44..115 CDD:238684 52/70 (74%)
Sox_C_TAD 178..381 CDD:288887 43/228 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5807
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm44833
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.