DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sox13

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_006249824.1 Gene:Sox13 / 289026 RGDID:1309674 Length:613 Species:Rattus norvegicus


Alignment Length:424 Identity:106/424 - (25%)
Similarity:164/424 - (38%) Gaps:115/424 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EHPHHLLTNYNSKKYPHVSRTPEYSHSTGSDYPEHGGYLTDGRLMHESNSDAGIYHVRQGSEHSS 72
            |:|..||   :|...|.|.|....:|....:.|:........::....|:.            ||
  Rat   253 EYPLQLL---HSPPAPVVKRPGVATHHPLQEPPQPLNLTAKPKVSELPNTS------------SS 302

  Fly    73 PSLH----SPAIQSSGYENEHLNEAVLAAHSHSHSPMPMVSSAYVGGGTASGSLINSNIPLLGGG 133
            |||.    .|...|.|.....|..          || |.:...::|.|.|....|.....||   
  Rat   303 PSLKMNSCGPRPSSHGAPTRDLQS----------SP-PNLPLGFLGEGDAVTKAIQDARQLL--- 353

  Fly   134 GNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCA-----------PNCGY 187
                      |.|:|.:           .:||       |..::.||.:           .||.:
  Rat   354 ----------HSHSGAL-----------ENSP-------SAPFRKDLISLDSSPAKERLEENCVH 390

  Fly   188 LERHKPLPADLKYRPGGTQ--SKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLG 250
            ......|..|:    .|::  |:|...|.|:|||||||||||.||:|:....||:||:.:||:||
  Rat   391 PLEEAMLGCDV----DGSRHFSESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILG 451

  Fly   251 KKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRK--------------QSKLRAMQPGG 301
            .:|:|:|.|:::||.||..||...|:.::|:|||:||.::              ::.:|..:.|.
  Rat   452 SRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCVVEGRRLRVGEYKALMRTRRQGA 516

  Fly   302 KEQSESSPNPGTGGSKSN---PKLATPPLATASSSY--------TTPTDESTCNSTNQNHGQS-- 353
            ::.....|..|.....|:   |:.|..|||.....:        ..|...:||:...:..|..  
  Rat   517 RQSYAIPPQAGQAQVSSDILFPRAAGMPLARPLVEHYDPQGLDPNMPVIINTCSLREEGEGTDDR 581

  Fly   354 ---TPGGLYEQPLKPTYSPSSVDCYSNADSTEQI 384
               ..|.:|.      ||... |...:..|.|::
  Rat   582 HSVADGEMYR------YSEDE-DSEGDEKSEEEL 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 37/70 (53%)
Sox13XP_006249824.1 Herpes_UL46 <251..>419 CDD:355696 46/226 (20%)
SOX-TCF_HMG-box 415..486 CDD:238684 37/70 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.