DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and matmc_2

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_595867.1 Gene:matmc_2 / 2539619 PomBaseID:SPBC23G7.09 Length:181 Species:Schizosaccharomyces pombe


Alignment Length:176 Identity:44/176 - (25%)
Similarity:71/176 - (40%) Gaps:47/176 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SHSPIEAASMWSYDY----------------------KG----------DLCAPNC-GYL----E 189
            ||..:.|.|..|||:                      ||          .:..||. .||    .
pombe     3 SHQELSAGSPISYDFLDPDWCFKRYLTKDALHSIETGKGAAYFVPDGFTPILIPNSQSYLLDGNS 67

  Fly   190 RHKPLPADLKYR------PG----GTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNAD 244
            ...|.|..:.:.      ||    ..:..:....|..||.|||:::.|.:...|...||.::|:.
pombe    68 AQLPRPQPISFTLDQCKVPGYILKSLRKDTTSTERTPRPPNAFILYRKEKHATLLKSNPSINNSQ 132

  Fly   245 LSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRK 290
            :||::|:.||:.:.:.|..|.:.:|..:..|...:|.|||:||:.|
pombe   133 VSKLVGEMWRNESKEVRMRYFKMSEFYKAQHQKMYPGYKYQPRKNK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 23/70 (33%)
matmc_2NP_595867.1 MATA_HMG-box 102..178 CDD:238685 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm47091
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.