DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sox21

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_808421.1 Gene:Sox21 / 223227 MGIID:2654070 Length:276 Species:Mus musculus


Alignment Length:229 Identity:71/229 - (31%)
Similarity:114/229 - (49%) Gaps:30/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEH 279
            ::|||||||||::.:|:|:|.|||.:||:::||.||.:|:.||..::||:::||:|||.:||.||
Mouse     8 VKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMKEH 72

  Fly   280 PNYKYRPRRR-----KQSKLRAMQPGGKEQSESSPNP----------GTGGS------KSNPKLA 323
            |:|||||||:     |:.|.....|.|......:.:|          |.||.      .:||:.|
Mouse    73 PDYKYRPRRKPKTLLKKDKFAFPVPYGLGSVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKA 137

  Fly   324 TPPLATASSSYTTPTDESTCNSTNQNHGQSTPGGLYE--QPLKPTYSPSSVDCYSNADSTEQIES 386
            ....|.|::....|...:...:........:|..|.:  ..:....|.||...|:::.......:
Mouse   138 AAAAAAAAARVFFPQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGA 202

  Fly   387 LAANCPPALLNESSPTGGGYDNSLLLKKLTKPSP 420
            .|.:...|....::...||:.:|       .|||
Mouse   203 GAFHGAAAAAAAAAAAAGGHTHS-------HPSP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/69 (55%)
Sox21NP_808421.1 SOX-TCF_HMG-box 7..78 CDD:238684 38/69 (55%)
SOXp 77..>95 CDD:403523 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.