DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sry

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_035694.1 Gene:Sry / 21674 MGIID:98660 Length:395 Species:Mus musculus


Alignment Length:90 Identity:44/90 - (48%)
Similarity:68/90 - (75%) Gaps:2/90 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 ESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHM 276
            |..::|||||||||::.||.|||.:||.:.|.::||.||.:|:|||..::||:.:||:||:::|.
Mouse     2 EGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHR 66

  Fly   277 TEHPNYKYRPRRRKQSKLRA--MQP 299
            .::|||||:|.||.:...|:  :||
Mouse    67 EKYPNYKYQPHRRAKVSQRSGILQP 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 38/74 (51%)
PHA03273 305..>391 CDD:223031
SryNP_035694.1 Sufficient for interaction with KPNB1. /evidence=ECO:0000250|UniProtKB:Q05066 4..81 40/76 (53%)
HMG-box_SoxA_SoxB_SoxG 4..79 CDD:438837 38/74 (51%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 6..22 11/15 (73%)
Sufficient for interaction with EP300. /evidence=ECO:0000250|UniProtKB:Q05066 52..84 15/31 (48%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 75..81 3/5 (60%)
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269|PubMed:15469996 92..144 44/90 (49%)
Necessary for interaction with SLC9A3R2 and nuclear accumulation of SLC9A3R2. /evidence=ECO:0000269|PubMed:16166090 94..138
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.