DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Tcf7

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_030101626.1 Gene:Tcf7 / 21414 MGIID:98507 Length:516 Species:Mus musculus


Alignment Length:481 Identity:104/481 - (21%)
Similarity:172/481 - (35%) Gaps:160/481 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEPSYDH---EHPHHLLTNYNSKKYPH-VSRTPE----YSHSTGSDYPEHGGYLTDGRLMHESNS 57
            :.|.|:|   .||.....:.:.|:..| ..:||:    ||.::||          .|:|.|..: 
Mouse   162 LSPLYEHFSSPHPTPAPADISQKQGVHRPLQTPDLSGFYSLTSGS----------MGQLPHTVS- 215

  Fly    58 DAGIYHVRQGSEHSSPSLHSPAIQSSGYENEHLNEAVLAAHSHSHSPMPMVS-SAYVGGGTASGS 121
                        ..||.|: |...|.||              ..|.|.|..: .|.....|....
Mouse   216 ------------WPSPPLY-PLSPSCGY--------------RQHFPAPTAAPGAPYPRFTHPSL 253

  Fly   122 LINSNIPLLGGGGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCAPNCG 186
            ::.|.:|              .||.|             ..|..|               .|:.|
Mouse   254 MLGSGVP--------------GHPAA-------------IPHPAI---------------VPSSG 276

  Fly   187 YLERHKPLPADLKYRPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGK 251
            ..|. :|...:||.:......|.||:..|::|:||||::.|..|.|:..|.....:|.::::||:
Mouse   277 KQEL-QPYDRNLKTQAEPKAEKEAKKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGR 340

  Fly   252 KWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRP---RRRKQSKLRAMQPGGKEQSESSPNPGT 313
            :|.:|:.:::..|.|.|.:.|.:||..:|.:..|.   :::::|:        ::..||:.:|| 
Mouse   341 RWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSR--------EKHQESTTDPG- 396

  Fly   314 GGSKSNPKLATPPLATASSSYTTPTDESTCNS---TNQNHGQSTPGGLYEQPLKPTYSPSSVDCY 375
                 :||                    .|.:   .||......|....::.::  |.|....|.
Mouse   397 -----SPK--------------------KCRARFGLNQQTDWCGPCRRKKKCIR--YLPGEGRCP 434

  Fly   376 SNADSTEQIESLAANCP--PA-------LLNESSPTGGGYDNSLLLKKLTKPSPSRAAKS----- 426
            |...|.:.    |..||  ||       ||..|.||.       ||....:|:|:.:.:|     
Mouse   435 SPVPSDDS----ALGCPRSPAPQDSPSYLLLPSFPTE-------LLASPVEPAPTFSGRSAALTL 488

  Fly   427 ---RQEKLAKSEEKNKGSQSQGQSQQ 449
               :..|...|..:|...|.|...:|
Mouse   489 PAPKSPKTPHSTLQNPQIQQQESQRQ 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 22/70 (31%)
Tcf7XP_030101626.1 CTNNB1_binding 20..216 CDD:369826 16/76 (21%)
SOX-TCF_HMG-box 304..374 CDD:238684 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.