DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sox15

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_033261.1 Gene:Sox15 / 20670 MGIID:98363 Length:231 Species:Mus musculus


Alignment Length:214 Identity:72/214 - (33%)
Similarity:113/214 - (52%) Gaps:35/214 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 PGGTQSKSAKES----------RIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSL 256
            |.|.|.:.|..|          :::|||||||||:.::|:::|.:||.:||:::||.||.:|:.|
Mouse    24 PLGPQEQEAGGSPGASGGLPLEKVKRPMNAFMVWSSVQRRQMAQQNPKMHNSEISKRLGAQWKLL 88

  Fly   257 TPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQP-----GGKEQSESSPNPG---T 313
            ..:::||:||||:|||..|:.::|:|||||||:.::......|     ||.....|...||   |
Mouse    89 GDEEKRPFVEEAKRLRARHLRDYPDYKYRPRRKSKNSSTGSVPFSQEGGGLACGGSHWGPGYTTT 153

  Fly   314 GGSK----SNPKLATPPL-ATASSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPLKPTYSPSSVD 373
            .||:    ..|..:|..| .:.:||:..|.....|     ...||.|  ..:..|:|::||    
Mouse   154 QGSRGFGYQPPNYSTAYLPGSYTSSHCRPEAPLPC-----TFPQSDP--RLQGELRPSFSP---- 207

  Fly   374 CYSNADSTEQIESLAANCP 392
             |.:.||:....:..|..|
Mouse   208 -YLSPDSSTPYNTSLAGAP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 34/70 (49%)
Sox15NP_033261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 10/30 (33%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000269|PubMed:16759287 1..45 10/30 (33%)
SOX-TCF_HMG-box 46..117 CDD:238684 32/70 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..136 6/32 (19%)
Interaction with FHL3. /evidence=ECO:0000269|PubMed:17363903 136..181 12/49 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..231 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838612
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.