DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sox11

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_033260.4 Gene:Sox11 / 20666 MGIID:98359 Length:395 Species:Mus musculus


Alignment Length:275 Identity:84/275 - (30%)
Similarity:123/275 - (44%) Gaps:63/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEH 279
            |:|||||||||:||||:|:.:::||:|||::||.|||:|:.|...::.|::.||||||:.||.::
Mouse    49 IKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADY 113

  Fly   280 PNYKYRPRRRKQSKLRAMQPGGKEQSESSPNPGTGGSKS--NP-----KLATPPLATASSSYTTP 337
            |:||||||::.::     .|..|..:..||:....|:|:  .|     ||..|.....:.....|
Mouse   114 PDYKYRPRKKPKT-----DPAAKPSAGQSPDKSAAGAKAAKGPGKKCAKLKAPAGKAGAGKAAQP 173

  Fly   338 TD-------------------------------ESTCNSTNQNHGQSTPGGLYEQP--LKPTYS- 368
            .|                               ::..:.....|....|....:||  |...|| 
Mouse   174 GDCAAGKAAKCVFLDDDDEDDDEDDELQLRPKPDADDDDDEPAHSHLLPPPTQQQPPQLLRRYSV 238

  Fly   369 ---PSSVDCYSNADSTEQIESLAANCPPALLNESSPTGGGYDNSLLLKKLTK--PSPSRAAKSRQ 428
               |:|....|.|:|.|          .|.|.:....||....|  .|.:||  |.|:..|.|..
Mouse   239 AKVPASPTLSSAAESPE----------GASLYDEVRAGGRLYYS--FKNITKQQPPPAPPALSPA 291

  Fly   429 EKLAKSEEKNKGSQS 443
            .....|...:.||.|
Mouse   292 SSRCVSTSSSSGSSS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 39/69 (57%)
Sox11NP_033260.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
SOX-TCF_HMG-box 48..119 CDD:238684 39/69 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..258 32/158 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..312 10/31 (32%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000269|PubMed:18403418 363..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.