DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox-2

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_741836.1 Gene:sox-2 / 181002 WormBaseID:WBGene00004949 Length:283 Species:Caenorhabditis elegans


Alignment Length:294 Identity:94/294 - (31%)
Similarity:137/294 - (46%) Gaps:83/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 MVGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCAPNCGYLERHKP-----------LPADLKYRP 202
            |:...:.:|:|         .|.||:.:              |.|           :|.||...|
 Worm     2 MMDPDSAKMQD---------YSGWSFGF--------------HMPPTSSTNLLPQSMPDDLSNGP 43

  Fly   203 GGTQS--KSAK--ESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRP 263
            ....|  |..|  :.|::|||||||||::.:|||:|.|||.:||:::||.||.:|:.|:.|::||
 Worm    44 DSPDSTGKDGKKNDDRVKRPMNAFMVWSRGQRKKMALENPKMHNSEISKRLGTEWKMLSEQEKRP 108

  Fly   264 YVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQPGGKEQSESSPNPGTGGSKSNPKLATP--- 325
            :::||:|||.|||.|||:|||||||:.:|                         .|.|...|   
 Worm   109 FIDEAKRLRAIHMKEHPDYKYRPRRKTKS-------------------------INKKNGAPIPF 148

  Fly   326 -PLATASSSYTTPTDESTCNSTNQNHGQ------STPGGLYEQPLKPTYSPSSVDCYSNADSTEQ 383
             .|.|.:.||  ||..:..|:|||...|      .|...:.:.|...||...||...:::.|..|
 Worm   149 GNLDTKTPSY--PTLTTNWNATNQYIDQFRFAPYPTTTVMDQIPFSLTYPVHSVPTDNSSPSQFQ 211

  Fly   384 IESLAANCPPALL---NESSPTG-----GGYDNS 409
            ...::.|...:.|   :||||.|     |..|:|
 Worm   212 PSPMSTNFAGSYLTPKSESSPVGSDSTVGTVDSS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 41/70 (59%)
sox-2NP_741836.1 SOX-TCF_HMG-box 59..130 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.