DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and egl-13

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001024918.1 Gene:egl-13 / 180833 WormBaseID:WBGene00001182 Length:470 Species:Caenorhabditis elegans


Alignment Length:389 Identity:100/389 - (25%)
Similarity:151/389 - (38%) Gaps:138/389 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PHHLLTNYNSKKYPH----------VSRTPEYSHSTG-SDYP------EHG-GYLTDGRLMHE-- 54
            |.|:....|....||          :|.....|.:|| ||:|      ||| ..|.||..:.|  
 Worm    46 PGHMDDTPNPAGSPHDASIKSSSSTISDHTSTSATTGISDFPDILAQTEHGCSVLIDGNHLREII 110

  Fly    55 ---------------------------SNSDAGIY-HVRQGSEHSSPSLHSPAIQSSGYENEHLN 91
                                       :|.::.:. .:::..:..||.||:....|         
 Worm   111 NSVDTQDGKQDLLSDVIRQLTSIKERLTNDESPVKDDLKEDPDDMSPMLHAGNFDS--------- 166

  Fly    92 EAVLAAHS-HSHSPMPMVSSAYVGGGTASGSLINSNIPLLGGGG--------NSVLNK----FLS 143
            |.:|..|. ..|....|:        .|:......::|||..||        |.|||.    .|.
 Worm   167 EMLLRQHELMQHQQQQMI--------IANMLKATQSLPLLFNGGLNYEAILNNPVLNATIAGHLP 223

  Fly   144 HPHAGMVG----------GGTGQME-------------DCTS-----HSPIEAASM-----WSYD 175
            :|.|..:.          ...|.|:             |..|     .||:....:     .:|.
 Worm   224 NPLASNISLLQKSISAKLAAAGNMQTVEKVETPLNLSKDTPSPTAIPQSPLSGFRLPYSLGTNYG 288

  Fly   176 YKGDL---CAPNCGYLERHKPLPADLKYRPGGT-----------QSKSAKESRIRRPMNAFMVWA 226
            ..|.|   |:||           :..|..||.|           |:||  .:.|:||||||||||
 Worm   289 SDGQLFNNCSPN-----------SSGKSTPGNTSVTSEVATPRPQAKS--PNHIKRPMNAFMVWA 340

  Fly   227 KIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRK 290
            :.||:|:....||:||:::||:||.:|:.::..:::||.||..||..:||.:||:|:||||.::
 Worm   341 RDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPKR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 34/70 (49%)
egl-13NP_001024918.1 SOX-TCF_HMG-box 328..399 CDD:238684 34/70 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.