DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Lef1

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001365988.1 Gene:Lef1 / 16842 MGIID:96770 Length:412 Species:Mus musculus


Alignment Length:364 Identity:83/364 - (22%)
Similarity:146/364 - (40%) Gaps:96/364 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EHPHHLLTNYNSKKYPHVSRTPEYS-HSTGSDYPEHGGYLTDGRLMHESNSDAGIYHVRQGSEHS 71
            :.|:|    ..::::|...:.|:.. ::.|..|..:.||:    :|...|||.   ::..||  .
Mouse    78 QEPYH----DKAREHPDEGKHPDGGLYNKGPSYSSYSGYI----MMPNMNSDP---YMSNGS--L 129

  Fly    72 SP-----SLHSPAIQSS----------GYENEHLNEAVLAAHSHS----------HSPMPMVSSA 111
            ||     |...|.:|.|          .|.:||.:.....:|..|          |.|.|.:.:.
Mouse   130 SPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPEIPTF 194

  Fly   112 Y------VGGGTA----SGSLINSNIPLLGG---------GGNSVLNKFLSHPHAGMVGGGTGQM 157
            |      ||..|.    .|..:   .|:.||         .|::.:::|..|    |:.|..|..
Mouse   195 YPLSPGGVGQITPPIGWQGQPV---YPITGGFRQPYPSSLSGDTSMSRFSHH----MIPGPPGPH 252

  Fly   158 EDCTSHSPIEAASMWSYDYKGDLCAPNCGYLERHKPLPADLKY-RPGGTQSKSAKESR--IRRPM 219
            .....|..|....:                .:.|....:||.: :|...|.|..:..|  |::|:
Mouse   253 TTGIPHPAIVTPQV----------------KQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPL 301

  Fly   220 NAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKY 284
            ||||::.|..|..:..|.....:|.::::||::|.:|:.:::..|.|.|.:.|.:||..:|.:..
Mouse   302 NAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSA 366

  Fly   285 R-----PRRRKQSKLRAMQPGGKEQS-------ESSPNP 311
            |     .::||:.||:....|||..|       .::|.|
Mouse   367 RDNYGKKKKRKREKLQESTSGGKRSSFPTCKAKAATPGP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 22/72 (31%)
Lef1NP_001365988.1 CTNNB1_binding 1..211 CDD:400583 32/145 (22%)
CTNNB1-binding 1..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..102 4/27 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..191 5/26 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..296 7/45 (16%)
SOX-TCF_HMG-box 296..367 CDD:238684 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.