DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Lef1

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_006233364.1 Gene:Lef1 / 161452 RGDID:620241 Length:412 Species:Rattus norvegicus


Alignment Length:371 Identity:87/371 - (23%)
Similarity:145/371 - (39%) Gaps:105/371 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPSYD--HEHPHHLLTNYNSKKYPHVSRTPEYSHSTGSDYPEHGGYLTDGRLMHESNSDAGIYHV 64
            ||.:|  .|||       :..|:|...     .::.|..|..:.||:    :|...|||.   ::
  Rat    79 EPYHDKAREHP-------DDGKHPDGG-----LYNKGPSYSSYSGYI----MMPNMNSDP---YM 124

  Fly    65 RQGSEHSSP-----SLHSPAIQSS----------GYENEHLNEAVLAAHSHS----------HSP 104
            ..||  .||     |...|.:|.|          .|.:||.:.....:|..|          |.|
  Rat   125 SNGS--LSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSEVNPKQGMSRHPP 187

  Fly   105 MPMVSSAY------VGGGTA----SGSLINSNIPLLGG---------GGNSVLNKFLSHPHAGMV 150
            .|.:.:.|      ||..|.    .|..:   .|:.||         .|::.:::|..|    |:
  Rat   188 APEMPTFYPLSPGGVGQITPPLGWQGQPV---YPITGGFRQAYPSSLSGDTSMSRFSHH----MI 245

  Fly   151 GGGTGQMEDCTSHSPIEAASMWSYDYKGDLCAPNCGYLERHKPLPADLKY-RPGGTQSKSAKESR 214
            .|..|.......|..|....:                .:.|....:||.: :|...|.|..:..|
  Rat   246 PGPPGPHTTGIPHPAIVTPQV----------------KQEHPHTDSDLMHVKPQHEQRKEQEPKR 294

  Fly   215 --IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMT 277
              |::|:||||::.|..|..:..|.....:|.::::||::|.:|:.:::..|.|.|.:.|.:||.
  Rat   295 PHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQ 359

  Fly   278 EHPNYKYR-----PRRRKQSKLRAMQPGGKEQS-------ESSPNP 311
            .:|.:..|     .::||:.||:....|||..|       .::|.|
  Rat   360 LYPGWSARDNYGKKKKRKREKLQESTSGGKRNSFPTCKAKAATPGP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 22/72 (31%)
Lef1XP_006233364.1 CTNNB1_binding 1..211 CDD:285538 36/152 (24%)
SOX-TCF_HMG-box 296..367 CDD:238684 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.