DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sox5

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_006237666.1 Gene:Sox5 / 140587 RGDID:620471 Length:764 Species:Rattus norvegicus


Alignment Length:391 Identity:98/391 - (25%)
Similarity:160/391 - (40%) Gaps:102/391 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GRLMHESNSDAGIYHVRQGSEHSSPSLHSPAIQSSGYENEHLNEAVLAAHSHSHSP----MPMVS 109
            |:|:.....:.|. .|...|.|:..|.:||..:|.....:.||.:.....|...||    .|.:.
  Rat   356 GKLLGLPQGNLGA-AVSPTSIHTDKSTNSPPPKSKDEVAQPLNLSAKPKTSDGKSPASPTSPHMP 419

  Fly   110 SAYVGGGTASGSLINSNIPLLGGGGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAASM--- 171
            :..:..|...   :.:::|..           |:.|.|.:...|.....|..:.:..||..|   
  Rat   420 ALRINSGAGP---LKASVPAA-----------LASPSARVSTIGYLNDHDAVTKAIQEARQMKEQ 470

  Fly   172 -----WSYDYK----GDLCAPNCGYLERHKP---------------------------LPADLKY 200
                 .:.|.|    ..:...|| ..|:.|.                           :..|...
  Rat   471 LRREQQALDGKVAVVNSIGISNC-RTEKEKTTLESLTQQLAVKQNEEGKFSHGMMDFNMSGDSDG 534

  Fly   201 RPGGTQSKSAKESR--------IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLT 257
            ..|.::|:..:|||        |:|||||||||||.||:|:....||:||:::||:||.:|:::|
  Rat   535 SAGVSESRIYRESRGRGSNEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMT 599

  Fly   258 PQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQ-----SKLR-----AMQPGGKEQSESSPNPG 312
            ..:::||.||..||...|:.::|:|||:||.::.     .|||     |:....:::.....|.|
  Rat   600 NLEKQPYYEEQARLSKQHLEKYPDYKYKPRPKRTCLVDGKKLRIGEYKAIMRNRRQEMRQYFNVG 664

  Fly   313 TGGSKSNPKLATPPLATASSSYT------------TPTDESTCNSTNQNHG----QSTPGGLYEQ 361
                    :.|..|:|||...|.            .|::.|:.:|:.: .|    |||.|...|:
  Rat   665 --------QQAQIPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSSSPE-PGMPVIQSTYGVKGEE 720

  Fly   362 P 362
            |
  Rat   721 P 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 36/78 (46%)
Sox5XP_006237666.1 SOX-TCF_HMG-box 556..627 CDD:238684 35/70 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.