DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and HMGB4

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_660206.2 Gene:HMGB4 / 127540 HGNCID:24954 Length:186 Species:Homo sapiens


Alignment Length:95 Identity:25/95 - (26%)
Similarity:46/95 - (48%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 GTQSKSAKE--SRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVE 266
            |.:.|..|.  ...|||.::|:::.:....:|..|||:.....::|..||.|.:.|..::.||.:
Human    80 GKRKKRRKRDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQ 144

  Fly   267 EAERLRVIHMTEHPNYKYRPRRRKQSKLRA 296
            ....||..:..|...|:.:...||:.::.|
Human   145 RVALLRAKYFEELELYRKQCNARKKYRMSA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 19/74 (26%)
PHA03273 305..>391 CDD:223031
HMGB4NP_660206.2 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..98 6/17 (35%)
HMG-box_HMGB_rpt2 91..161 CDD:438795 18/69 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.