DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox32

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_571926.1 Gene:sox32 / 116990 ZFINID:ZDB-GENE-011026-1 Length:307 Species:Danio rerio


Alignment Length:239 Identity:86/239 - (35%)
Similarity:116/239 - (48%) Gaps:68/239 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 CGYLER---------HKPLPADLKYRPGGTQS-------KSAKESRIRRPMNAFMVWAKIERKKL 233
            |.||:.         |.|....|.....|::|       |:..|:|:|||:|||::|.|.||::|
Zfish    24 CHYLQHQNDEQRRTAHCPASGPLSPVSVGSESSCSSPEAKAPVETRVRRPLNAFIIWTKEERRRL 88

  Fly   234 ADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQ 298
            |..||||.|.||||:|||.|::::..|:|||::||||||:.|..::|||||||||||.:|..:..
Zfish    89 AQLNPDLENTDLSKILGKTWKAMSLADKRPYMQEAERLRIQHTIDYPNYKYRPRRRKCNKRSSKM 153

  Fly   299 PGGKEQSESSPN--------------------------PGTGGSKSNPKLATPPLATASSSYTTP 337
            |  ..::.||||                          |..|.|..|          .||||.. 
Zfish   154 P--SSENVSSPNATFDLSYMFQGQAPQRPYNQINSYRLPHNGFSFEN----------HSSSYHF- 205

  Fly   338 TDESTCNSTNQNHGQST---------PGGLYEQPLKPTYSPSSV 372
              |:|.:|.|..||.:|         |...|.:.|  .||..||
Zfish   206 --EATSSSGNVFHGGATSMNLSNVHLPRSAYSESL--LYSQHSV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 41/70 (59%)
sox32NP_571926.1 SOX-TCF_HMG-box 69..140 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.