DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and SOX30

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_848511.1 Gene:SOX30 / 11063 HGNCID:30635 Length:753 Species:Homo sapiens


Alignment Length:464 Identity:112/464 - (24%)
Similarity:171/464 - (36%) Gaps:123/464 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LPADLKYRPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTP 258
            ||:|... |....||. :...::||||||||||:|.|..||..||..:||::|..||.:|..|:.
Human   318 LPSDAGI-PDTPFSKD-RNGHVKRPMNAFMVWARIHRPALAKANPAANNAEISVQLGLEWNKLSE 380

  Fly   259 QDRRPYVEEAERLRVIHMTEHPNYKYRPR--RRKQSKLRAMQP-GGKEQSESSPNPGTGGSKSNP 320
            :.::||.:||::::..|..|.|.:.|:||  :||:..|..... .|..|:..|.||.|       
Human   381 EQKKPYYDEAQKIKEKHREEFPGWVYQPRPGKRKRFPLSVSNVFSGTTQNIISTNPTT------- 438

  Fly   321 KLATPPLATASSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPLKPTYSPSSVDCYS-NADSTEQI 384
               ..|..:.:.|...|   |..|......|:::|.  .:.|.....|||.|..:. :..|..|:
Human   439 ---VYPYRSPTYSVVIP---SLQNPITHPVGETSPA--IQLPTPAVQSPSPVTLFQPSVSSAAQV 495

  Fly   385 ESLAANCP--PALLNESSPTGGGYDNSLLLKKLTKPSPSRAAKSRQEKLAKSEEKNKGSQSQGQS 447
            .....:.|  |||     |.          ::.|.||.:...:...|                  
Human   496 AVQDPSLPVYPAL-----PP----------QRFTGPSQTDTHQLHSE------------------ 527

  Fly   448 QQGIYAATYPL-APTSVAVVAARGMYVTCNNRGLLDHGHSVKGTFYPP---VSVSEDDNSTSMRN 508
                  ||:.: .||.|::.:|..:..:.:..    |......|..||   .|||....|..:..
Human   528 ------ATHTVKQPTPVSLESANRISSSASTA----HARFATSTIQPPREYSSVSPCPRSAPIPQ 582

  Fly   509 SISALQQHC--NVVTSTPSSSGGTMPTSEMSSYTVSMADNCGNLRLSMNE---LSGNEYLPSAN- 567
            :......|.  ......|::..||.|                  |.|.:.   |.|..|.||:. 
Human   583 ASPIPHPHVYQPPPLGHPATLFGTPP------------------RFSFHHPYFLPGPHYFPSSTC 629

  Fly   568 -------AYG----------MQYEDFLRYQSNDMDYST-----SAVEHKETTSDSASGQKCLKYP 610
                   .||          ..|||  ||..::..:||     |..::....:.|.:.:.|    
Human   630 PYSRPPFGYGNFPSSMPECLSYYED--RYPKHEGIFSTLNRDYSFRDYSSECTHSENSRSC---- 688

  Fly   611 DTNQNYDDY 619
             .|.|...|
Human   689 -ENMNGTSY 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 30/70 (43%)
SOX30NP_848511.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..161
SOX-TCF_HMG-box 336..406 CDD:238684 30/69 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 514..575 17/88 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 726..753
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.