DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sry3A

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001403665.1 Gene:Sry3A / 103694554 RGDID:9120067 Length:169 Species:Rattus norvegicus


Alignment Length:78 Identity:40/78 - (51%)
Similarity:62/78 - (79%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 ESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHM 276
            |..::|||||||||::.||:|||.:||.:.|:::||.||.:|:|||..::||:.:||:||:.:|.
  Rat     2 EGHVKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKQLGYQWKSLTEAEKRPFFQEAQRLKTLHR 66

  Fly   277 TEHPNYKYRPRRR 289
            .::|||||:..||
  Rat    67 EKYPNYKYQTHRR 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 37/74 (50%)
PHA03273 305..>391 CDD:223031
Sry3ANP_001403665.1 HMG-box_SoxA_SoxB_SoxG 4..79 CDD:438837 37/74 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.