DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox6

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_031755685.1 Gene:sox6 / 100144640 XenbaseID:XB-GENE-483934 Length:804 Species:Xenopus tropicalis


Alignment Length:470 Identity:113/470 - (24%)
Similarity:180/470 - (38%) Gaps:155/470 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YPHVSRT--------------PEYSHSTGSDYPEH----------GGYLTDGRLMHESNSDAGIY 62
            :||..||              |..|:..|.:||..          ...|:..:|..       :|
 Frog   300 FPHDQRTLAAAAAAQQGFLFPPGLSYKPGDNYPMQFIPSTMAAAAASGLSPLQLQQ-------LY 357

  Fly    63 HVRQGSEHSSPSLHSP----------AIQSSGYENEH----------------LN--------EA 93
            ..:..|...||....|          .:..:|.::|.                ||        :.
 Frog   358 AAQLASMQVSPGAKIPTTPQPANAPGTLSPTGMKSEKRGTSPVAQIKDEAAQPLNLSARPKTADP 422

  Fly    94 VLAAHSHSHSPMPMVSSAYVGGGTASG----------SLINS-NIPLLGGGGNSVLNKF------ 141
            :.:..|.:.|..|:..::.|.....||          .:::| |.|.|.|..::|:...      
 Frog   423 IKSPTSPTQSFFPVSKTSPVSLSNKSGIPSPIRGPSLDILSSLNSPALFGDQDTVMKAIQEARKM 487

  Fly   142 --------LSHPHA--GMVGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCA----------PNCG 186
                    |..||:  |.:......:.:|.|...:..|      ..|.:|.          .|.|
 Frog   488 REQIQREQLLTPHSIDGKLPINNMGLNNCRSDKMLLDA------VTGKICIRSAHTERTHFENLG 546

  Fly   187 YLERHKPLPADLKYRPG-----------------------GTQSKSAKESRIRRPMNAFMVWAKI 228
            .....|| ..|.|..||                       .|:.:|:.|..|:|||||||||||.
 Frog   547 PQLTGKP-NEDGKLGPGVIDLTRPEDVEGGATVVEARVYRDTRGRSSSEPHIKRPMNAFMVWAKD 610

  Fly   229 ERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQ-- 291
            ||:|:....||:||:::||:||.:|::::.|:::||.||..||..||:.::|||||:||.::.  
 Frog   611 ERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCI 675

  Fly   292 ---SKLR------AMQPGGKEQSESSPNPGTGGSKSNPKLATP-----PLATASSSYTTPTDEST 342
               .|||      .|:...:|..:..    |.|.:....::||     | .|.|.:.|||:.:.|
 Frog   676 VDGKKLRIGEYKQLMRSRRQEMRQFF----TVGQQPQIPISTPTGVVYP-GTISMATTTPSPQMT 735

  Fly   343 --CNSTNQNHGQSTP 355
              |:||:.:...|.|
 Frog   736 SDCSSTSASPEPSIP 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 37/70 (53%)
sox6XP_031755685.1 SOX-TCF_HMG-box 596..667 CDD:238684 37/70 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.