DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox21

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_002939326.1 Gene:sox21 / 100038091 XenbaseID:XB-GENE-486445 Length:271 Species:Xenopus tropicalis


Alignment Length:235 Identity:76/235 - (32%)
Similarity:117/235 - (49%) Gaps:48/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEH 279
            ::|||||||||::.:|:|:|.|||.:||:::||.||.:|:.||..::||:::||:|||.:||.||
 Frog     8 VKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTEAEKRPFIDEAKRLRAMHMKEH 72

  Fly   280 PNYKYRPRRRKQSKLRAMQPGGKEQSESSPNP----------------GTGGSK----SNPKLAT 324
            |:|||||||:.::.|       |:...:.|.|                |.|...    |||:.|.
 Frog    73 PDYKYRPRRKPKTLL-------KKDKFAFPMPYGFTGDHDGLKVAGLHGAGALTDSLLSNPEKAA 130

  Fly   325 PPLATASSSYTTPTDESTCNST------NQNHGQSTPGGLYEQPLKP---TYSPSSVDCYSNADS 380
            ...|.|::....|...:...:.      ..||    |..|::...|.   |.|.||:. |:::..
 Frog   131 AAAAAAAARVFFPPSAAAAAAAAAAAAGGANH----PYSLFDLSSKMAEITSSSSSLP-YTSSIG 190

  Fly   381 TEQIESLAANCPPALLNESSPTGGGYDNSLLLKKLTKPSP 420
            ..|....|.....|....::..|||:.:|       .|||
 Frog   191 YPQASGGAFPGVAAAAAAAAAAGGGHTHS-------HPSP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/69 (55%)
sox21XP_002939326.1 SOX-TCF_HMG-box 7..78 CDD:238684 38/69 (55%)
SOXp 77..>95 CDD:372055 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.