DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VGAT and LAX3

DIOPT Version :9

Sequence 1:NP_610938.1 Gene:VGAT / 36574 FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_177892.1 Gene:LAX3 / 844105 AraportID:AT1G77690 Length:470 Species:Arabidopsis thaliana


Alignment Length:298 Identity:51/298 - (17%)
Similarity:98/298 - (32%) Gaps:77/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 LLMTCILYVVVCGDLLAGTYPQGSFDSRSWMLFVGIFLLPMGFLKSLKMVSTLSFWCTMSHIVIN 301
            ||...::.::.|...:  .|.....|.|:|....|.......|:.|.......||          
plant   144 LLFGSVIQLIACASNI--YYINDKLDKRTWTYIFGACCATTVFIPSFHNYRIWSF---------- 196

  Fly   302 AVILGYCLLQIGDW---------GWSKVRFSIDMENFPISLGVIVFSYTSQIFLPTLEGNMIDRS 357
               ||..:.....|         |.::     |:::...:..|:.|:..:.| |.|..|:.:...
plant   197 ---LGLAMTTYTSWYLTIASLLHGQAE-----DVKHSGPTTMVLYFTGATNI-LYTFGGHAVTVE 252

  Fly   358 KFNWMLDWS-HIAAAVFKAGFGYICFLTFQNDT-------QQVITNN-----LHSQGFKGMVNFF 409
            ..:.|  |. ....|::.....|:..||..:.:       .:::|::     |...||:......
plant   253 IMHAM--WKPQKFKAIYLLATIYVLTLTLPSASAVYWAFGDKLLTHSNALSLLPKTGFRDTAVIL 315

  Fly   410 LVIKALLSYPLPYYAACELLERNFFRGPPKTKFPTIWNLDGELKVWGLG----------FRVGVI 464
            ::|...:::                 |...|....:|.     |:.|:.          .|:.|:
plant   316 MLIHQFITF-----------------GFASTPLYFVWE-----KLIGVHETKSMFKRAMARLPVV 358

  Fly   465 VSTILMAIFIPHFSILMGFIGSFTGTMLSFIWPCYFHI 502
            |....:||..|.|..:...:||...:...:|.|...|:
plant   359 VPIWFLAIIFPFFGPINSAVGSLLVSFTVYIIPALAHM 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:382020 51/298 (17%)
LAX3NP_177892.1 PLN03074 1..470 CDD:215559 51/298 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.