DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VGAT and AT1G71680

DIOPT Version :9

Sequence 1:NP_610938.1 Gene:VGAT / 36574 FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_565019.2 Gene:AT1G71680 / 843494 AraportID:AT1G71680 Length:448 Species:Arabidopsis thaliana


Alignment Length:427 Identity:96/427 - (22%)
Similarity:149/427 - (34%) Gaps:125/427 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 QAAW------NVTNAIQGMFIVSLPFAVLHGGYW--AIVAMVGIAHICCYTGKVLVQCLYEPDPA 201
            :|.|      ||| |:.|..::.||||:...| |  .:||::....|..|:...:|| |:|..| 
plant    36 EAKWYYSAFHNVT-AMVGAGVLGLPFAMSQLG-WGPGLVAIIMSWAITFYSLWQMVQ-LHEAVP- 96

  Fly   202 TGQMVRVRDSYVAIAKVCFGPKLGARAVSIAQLIELLMTCILYVVVCGDLLAGTYPQGSFDSRSW 266
             |:.:   |.|..:.:..||||||...|...||:..:.:.|:|.|..|                 
plant    97 -GKRL---DRYPELGQEAFGPKLGYWIVMPQQLLVQIASDIVYNVTGG----------------- 140

  Fly   267 MLFVGIFLLPMGFLKSLKMVSTLSFWCTMSHIVINAVILGYCLLQI-----GDWGWSKV------ 320
                          ||||....|.| ..:.||.....|||:..||:     .|:...|:      
plant   141 --------------KSLKKFVELLF-PNLEHIRQTYYILGFAALQLVLSQSPDFNSIKIVSLLAA 190

  Fly   321 --RFSIDM-----------ENFPISLGVIVFSYTSQIF-----LPTL----EGNMIDRSKFNWML 363
              .|...|           |:.|.:.||...:..|.:|     :.|:    .|:.:       :|
plant   191 LMSFLYSMIASVASIAKGTEHRPSTYGVRGDTVASMVFDAFNGIGTIAFAFAGHSV-------VL 248

  Fly   364 D-----------------WSHIAAA--------VFKAGFGYICFLTFQNDTQQVITNNLHSQGFK 403
            :                 |..:..|        :|.|..||..|.....|  .|:.:........
plant   249 EIQATIPSTPEVPSKKPMWKGVVVAYIIVIICYLFVAISGYWAFGAHVED--DVLISLERPAWLI 311

  Fly   404 GMVNFFLVIKALLSYPLPYYAACELLERNFFRGPPKTKFPTIWNLDGELKVWGLGFRVGVIVSTI 468
            ...||.:.|..:.||.:......:.:|....:....|...|:          .|..|...:....
plant   312 AAANFMVFIHVIGSYQVFAMIVFDTIESYLVKTLKFTPSTTL----------RLVARSTYVALIC 366

  Fly   469 LMAIFIPHFSILMGFIGSFTGTMLSFIWPCYFHIKIK 505
            |:|:.||.|..|:||.|....:..|:..||...:.:|
plant   367 LVAVCIPFFGGLLGFFGGLVFSSTSYFLPCIIWLIMK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:382020 96/427 (22%)
AT1G71680NP_565019.2 SLC5-6-like_sbd 37..432 CDD:294310 96/426 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570025at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48017
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X361
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.