DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VGAT and CG30394

DIOPT Version :9

Sequence 1:NP_610938.1 Gene:VGAT / 36574 FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_611578.1 Gene:CG30394 / 37437 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster


Alignment Length:453 Identity:103/453 - (22%)
Similarity:182/453 - (40%) Gaps:105/453 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 VTNAIQGMFIVSLPFAVLHGG-YWAIVAMV---GIAHICCYTGKVLVQCLYEPDPATGQMVRVRD 210
            :.|:|.|:.|:::||.....| ..:||.:|   ||..:||:   .|::        |..:.| |.
  Fly    11 LANSIIGVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCH---YLIK--------TSLLTR-RR 63

  Fly   211 SYVAIAKVCFGPKLGARAVSIAQLIELLMTCILYVVVCGDL----LAGTYPQGSFDS---RSWML 268
            |:..:....||.. |...|.:..:..|:.|||.|.||.|||    :|..:.....|.   ||.::
  Fly    64 SFEMLGLHAFGTS-GKLLVELCIIGYLIGTCITYFVVVGDLGPQIIAKIFALDVADHLHLRSLVM 127

  Fly   269 FV--GIFLLPMGFLKSLKMVSTLSFWCTMS-----HIVINAVILGYCLLQIGDWG-----WS--- 318
            .|  .:.::|:|.|::   |.:||..||.|     .:::..|:.....:...||.     |.   
  Fly   128 VVVTVVCIVPLGMLRN---VDSLSAVCTASIGFYVCLILKIVLEAQPHITANDWTEKVLYWEPAG 189

  Fly   319 --------KVRFSIDMENFPISLGVIVFSYTSQIFLPTLEGNMIDRSKFNWMLDWSHIAAAVFKA 375
                    .:..|..|:.|.      ||...:...|..|.|  |.|:. .|:..:.:|:...   
  Fly   190 VLQCLPIFSMALSCQMQLFE------VFESINNQSLDKLNG--IVRNA-TWICTFVYISVGF--- 242

  Fly   376 GFGYICFL--TFQNDTQQVITNNLHSQGFKGMVNFFLVIKALLSYPL---PYYAACELL------ 429
             |||:.|.  ||..:    |..||.:.....::....|:....|:||   |..|:...|      
  Fly   243 -FGYVAFCTHTFSGN----ILVNLSTSFGSDIIKIGFVLSIAFSFPLVIFPCRASLYSLLYRKGH 302

  Fly   430 -ERNFFRGPPKTKFPTIWNLDGELKVWGLGFRVGVIVSTILMAIFIPHFSILMGFIGSFTGTMLS 493
             |.:.:....:.:|.||:                ::|.::.:|:.||...:::|.:||..|..:.
  Fly   303 TESSSYIPEQRFRFITIF----------------IVVFSLCVALVIPSVELIIGLVGSTIGVAIC 351

  Fly   494 FIWPCYFHIKIKGHLLDQKEIAKDYLIIGLGVLFGVIGIYDSGNAL--------INAFEIGLP 548
            .::|.....||......::.:|:  .:...|.|..::|.|.:.:|:        .:...||.|
  Fly   352 IMFPASSFRKIIKKESMERTLAQ--FVFVSGFLLMILGTYANLSAIDEKSSGPEFDMVAIGTP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:382020 98/428 (23%)
CG30394NP_611578.1 SdaC 8..392 CDD:223884 99/431 (23%)
SLC5-6-like_sbd 8..390 CDD:294310 98/429 (23%)
DUF4775 <394..652 CDD:292620 4/19 (21%)
YukC <561..660 CDD:295067
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468277
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.