DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VGAT and si:dkey-126h10.1

DIOPT Version :9

Sequence 1:NP_610938.1 Gene:VGAT / 36574 FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster
Sequence 2:XP_001342572.1 Gene:si:dkey-126h10.1 / 100002902 ZFINID:ZDB-GENE-070424-201 Length:454 Species:Danio rerio


Alignment Length:463 Identity:180/463 - (38%)
Similarity:271/463 - (58%) Gaps:46/463 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GDGDGEYRNEYQSTSFNEYDGRYQQTDGFRQGSIASEGSSFVCEGEGGGGCKIDEFQAAWNVTNA 153
            |...|::|::.|::|..:.|                       :.:......|..::|.||||||
Zfish    29 GQTYGDHRSQSQTSSPEDPD-----------------------QPQNTHSATITTWEAGWNVTNA 70

  Fly   154 IQGMFIVSLPFAVLHGGYWAIVAMVGIAHICCYTGKVLVQCLYEPDPATGQMVRVRDSYVAIAKV 218
            |||:|::.||:|:|..||..::.:|..|.||.||||:||.||||.| .:|..||||.:|..||..
Zfish    71 IQGLFVLGLPYALLQSGYLGLLLLVLAALICSYTGKILVSCLYEED-ESGCPVRVRHTYEDIANA 134

  Fly   219 C---FGPKLGARAVSIAQLIELLMTCILYVVVCGDLLAGT--YPQGSFDSRSWMLFVGIFLLPMG 278
            |   ..|.:|.:.|::|||:||:||||||:||.|:|:..:  :...|..:.|.:.|  :.|||..
Zfish   135 CCRHICPCIGGKVVNVAQLVELVMTCILYLVVSGNLMCHSLFFLHLSPTTGSAISF--LILLPCM 197

  Fly   279 FLKSLKMVSTLSFWCTMSHIVINAVILGYCLLQIGDWGWSKVRFS-IDMENFPISLGVIVFSYTS 342
            .::.|::||.||.:|:::..:|..:::|||:.|...|....:|.. :|.:.|.:::|||:|||||
Zfish   198 LIRDLRVVSRLSLFCSLAQFLITFIVIGYCVRQSPQWASRSLRADVVDFDGFQVAVGVIIFSYTS 262

  Fly   343 QIFLPTLEGNMIDRSKFNWMLDWSHIAAAVFKAGFGYICFLTFQNDTQQVITNNLHSQGFKGMVN 407
            ||:|||||.:|:||..||.|:||:|..|.|.|..|..:.|||:..:|::|||:||.| ..:.:||
Zfish   263 QIYLPTLEESMMDRLDFNTMMDWTHALACVLKTAFSVLAFLTWGEETKEVITDNLPS-ALRTVVN 326

  Fly   408 FFLVIKALLSYPLPYYAACELLERNFFRGPPKTKFPTIWNLDGELKVWG-LGFRVGVIVSTILMA 471
            ..|:.|||||||||:|||.|:|:....:            ||...:.|. |..|..:::.|:|||
Zfish   327 LCLLAKALLSYPLPFYAAAEILQTGLLK------------LDSGSERWTLLLLRGSLLLLTLLMA 379

  Fly   472 IFIPHFSILMGFIGSFTGTMLSFIWPCYFHIKIKGHLLDQKEIAKDYLIIGLGVLFGVIGIYDSG 536
            :|:|.||:|||..||.||..::.:.|..||:::|...||......|.||:.||....|.|:..|.
Zfish   380 LFVPRFSLLMGLTGSVTGAAMTLLLPALFHLQLKWTQLDLSRRMLDLLILLLGGFCSVSGVICSI 444

  Fly   537 NALINAFE 544
            ..:|.|||
Zfish   445 RGMITAFE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:382020 168/395 (43%)
si:dkey-126h10.1XP_001342572.1 SLC5-6-like_sbd 57..449 CDD:294310 170/407 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321223at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.