DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cg and ZNF142

DIOPT Version :9

Sequence 1:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_001353219.1 Gene:ZNF142 / 7701 HGNCID:12927 Length:1887 Species:Homo sapiens


Alignment Length:702 Identity:156/702 - (22%)
Similarity:234/702 - (33%) Gaps:189/702 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 KSHFSSIGA----LHLTQEECNEILIKRAIAAGH-HQTHTITAADGSHHHASGGTPSFCSVGGAT 224
            |||.::..|    |...||.|:.....|.....| .:||.:.|.:..||.        |.:..||
Human   473 KSHTAAAAAEPLPLRCFQEGCSYAAPDRKAFIKHLKETHGVRAVECRHHS--------CPMLFAT 529

  Fly   225 TLLGDILPGISVQVQKVIQGLEDNEDSQGEAPNLKLEPGTLELSPKTELQESMHFSETDATIKKE 289
                                                          .|..|:.|        |..
Human   530 ----------------------------------------------AEAMEAHH--------KSH 540

  Fly   290 RPYSCDEC-----GKSFLLKHHLTTH-------------------------ARVHTGERPHICTH 324
            ..:.|..|     .|....||....|                         .::|..|:.|.|..
Human   541 YAFHCPHCDFACSNKHLFRKHKKQGHPGSEELRCTFCPFATFNPVAYQDHVGKMHAHEKIHQCPE 605

  Fly   325 CGKSFAHKHCLNTHLLLHSTERPYQCQECKKSFT------LKHHLLTHSRVHSRERPFVCQECGR 383
            |..:.|||..|..|:|||:.|:|::|:.|  .||      |..|:||||..    :.::|.|||.
Human   606 CNFATAHKRVLIRHMLLHTGEKPHKCELC--DFTCRDVSYLSKHMLTHSNT----KDYMCTECGY 664

  Fly   384 AFPLKRHLVTHSKFHAGERPYVCEECGESFAQENHLIMHSRFHGSLNPFVCAECGASFPRKFQLV 448
            ....|.:|..|.:.|||:..|.|.:|.....:.:.|..|...|.. ...:|..|..:..||::|.
Human   665 VTKWKHYLRVHMRKHAGDLRYQCNQCSYRCHRADQLSSHKLRHQG-KSLMCEVCAFACKRKYELQ 728

  Fly   449 NH--GRIHGKIP---HSCTVCGKEFLQKRTLVSHMRRVHTGEQAHPCVSCGEGFLTKAELHQHVR 508
            .|  .:.|...|   :.|..|..:...|:.::||....||..:...|..|.....:...|..|.|
Human   729 KHMASQHHPGTPAPLYPCHYCSYQSRHKQAVLSHENCKHTRLREFHCALCDYRTFSNTTLLFHKR 793

  Fly   509 TAHNGVNPNTSSATIIANQQLQQAHH----------------------HQAGQQTHP---QTITV 548
            .||..|..:.:.....|:|:.:.|..                      |:.|....|   |.:..
Human   794 KAHGYVPGDQAWQLRYASQEPEGAMQGPTPPPDSEPSNQLSARPEGPGHEPGTVVDPSLDQALPE 858

  Fly   549 VSNPGNSTLLTVSTT----DANGVARPQFVCRECGSAFNSREALALHLRLHTGDKSLMTDLCALT 609
            :|...|:.....|..    |..|...|..|  |.||.....|||.:.|...|     ...|..:|
Human   859 MSEEVNTGRQEGSEAPHGGDLGGSPSPAEV--EEGSCTLHLEALGVELESVT-----EPPLEEVT 916

  Fly   610 AALPGHFLSTASLNP--------------GTV-VTANPNLVGQSPVPVQIISSTGQVMSQTTLVQ 659
            ...|..|.......|              ||. ::|..|.:.:.||..   .||    :..:|.:
Human   917 ETAPMEFRPLGLEGPDGLEGPELSSFEGIGTSDLSAEENPLLEKPVSE---PST----NPPSLEE 974

  Fly   660 AANS------THPQAVVTAVPTMPVHGQQQHLQHVAQQQQQQQQQQQQQQQHVVSVAPANKPKSH 718
            |.|:      |.|.|....:|.:|   :.:.|....::|.::|.:....:..|..|....:.::.
Human   975 APNNWVGTFKTTPPAETAPLPPLP---ESESLLKALRRQDKEQAEALVLEGRVQMVVIQGEGRAF 1036

  Fly   719 FCASCGKGFAAKHGLMQHNRRHPNGGCTVRTH--VC-ECGKAFFQKNHLMLH 767
            .|..|......:..|..|:|.    ||..|..  :| |||.:|.|:..|..|
Human  1037 RCPHCPFITRREKALNLHSRT----GCQGRREPLLCPECGASFKQQRGLSTH 1084

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cgNP_001097306.2 COG5048 287..>371 CDD:227381 32/119 (27%)
C2H2 Zn finger 294..314 CDD:275368 6/49 (12%)
zf-H2C2_2 306..331 CDD:290200 6/49 (12%)
C2H2 Zn finger 322..342 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 10/25 (40%)
zf-H2C2_2 362..385 CDD:290200 9/22 (41%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
zf-H2C2_2 390..415 CDD:290200 8/24 (33%)
C2H2 Zn finger 406..426 CDD:275368 4/19 (21%)
SIR2 <425..>465 CDD:294129 10/44 (23%)
C2H2 Zn finger 434..454 CDD:275368 6/21 (29%)
C2H2 Zn finger 461..482 CDD:275368 5/20 (25%)
C2H2 Zn finger 490..509 CDD:275368 4/18 (22%)
lambda-1 491..>603 CDD:212564 29/140 (21%)
C2H2 Zn finger 575..595 CDD:275368 7/19 (37%)
C2H2 Zn finger 720..740 CDD:275368 5/19 (26%)
C2H2 Zn finger 752..771 CDD:275368 8/17 (47%)
ZNF142NP_001353219.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
C2H2 Zn finger 365..385 CDD:275368
C2H2 Zn finger 393..413 CDD:275368
C2H2 Zn finger 421..438 CDD:275368
C2H2 Zn finger 455..475 CDD:275368 1/1 (100%)
C2H2 Zn finger 545..566 CDD:275368 5/20 (25%)
C2H2 Zn finger 574..595 CDD:275368 0/20 (0%)
zf-H2C2_5 601..625 CDD:404746 11/23 (48%)
C2H2 Zn finger 603..623 CDD:275368 8/19 (42%)
C2H2 Zn finger 631..651 CDD:275368 7/21 (33%)
C2H2 Zn finger 659..679 CDD:275368 7/19 (37%)
C2H2 Zn finger 687..707 CDD:275368 4/19 (21%)
C2H2 Zn finger 714..731 CDD:275368 5/16 (31%)
PHA03247 928..>1219 CDD:223021 38/171 (22%)
C2H2 Zn finger 1306..1353 CDD:275368
C2H2 Zn finger 1373..1394 CDD:275368
C2H2 Zn finger 1402..1422 CDD:275368
C2H2 Zn finger 1430..1451 CDD:275368
C2H2 Zn finger 1626..1646 CDD:275368
C2H2 Zn finger 1654..1674 CDD:275368
C2H2 Zn finger 1682..1702 CDD:275368
C2H2 Zn finger 1710..1730 CDD:275368
zf-H2C2_2 1723..1747 CDD:404364
C2H2 Zn finger 1738..1759 CDD:275368
C2H2 Zn finger 1767..1787 CDD:275368
C2H2 Zn finger 1795..1815 CDD:275368
C2H2 Zn finger 1823..1843 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.