DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cg and ZSCAN32

DIOPT Version :9

Sequence 1:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_001271456.1 Gene:ZSCAN32 / 54925 HGNCID:20812 Length:697 Species:Homo sapiens


Alignment Length:259 Identity:85/259 - (32%)
Similarity:114/259 - (44%) Gaps:43/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 VQVQKVIQ--------------GLEDNEDSQGEAPNLKLEPGTLELSPKTELQESM--------- 277
            |::.|.:|              |||....|:.:..|   .||  |...||..||.|         
Human   432 VEINKALQRKSRGVYWHSELQKGLESEPTSRRQCRN---SPG--ESEEKTPSQEKMSHQSFCARD 491

  Fly   278 ----HF-----------SETDATIKKERPYSCDECGKSFLLKHHLTTHARVHTGERPHICTHCGK 327
                |.           |.....:|.|:...|.||||:|....:|..|.|:||||:||.|:.|||
Human   492 KACTHILCGKNCSQSVHSPHKPALKLEKVSQCPECGKTFSRSSYLVRHQRIHTGEKPHKCSECGK 556

  Fly   328 SFAHKHCLNTHLLLHSTERPYQCQECKKSFTLKHHLLTHSRVHSRERPFVCQECGRAFPLKRHLV 392
            .|:.:..|..||..|:.||||||.:|.|||.....|:.|.|.|:.|:|:.|..||:.|.......
Human   557 GFSERSNLTAHLRTHTGERPYQCGQCGKSFNQSSSLIVHQRTHTGEKPYQCIVCGKRFNNSSQFS 621

  Fly   393 THSKFHAGERPYVCEECGESFAQENHLIMHSRFHGSLNPFVCAECGASFPRKFQLVNHGRIHGK 456
            .|.:.|.||.||.|..||:.|...:|...|.:.|....|:.|:.|...|.:...|..|..:|.|
Human   622 AHRRIHTGESPYKCAVCGKIFNNSSHFSAHRKTHTGEKPYRCSHCERGFTKNSALTRHQTVHMK 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cgNP_001097306.2 COG5048 287..>371 CDD:227381 39/83 (47%)
C2H2 Zn finger 294..314 CDD:275368 9/19 (47%)
zf-H2C2_2 306..331 CDD:290200 14/24 (58%)
C2H2 Zn finger 322..342 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
zf-H2C2_2 362..385 CDD:290200 9/22 (41%)
C2H2 Zn finger 378..398 CDD:275368 5/19 (26%)
zf-H2C2_2 390..415 CDD:290200 10/24 (42%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
SIR2 <425..>465 CDD:294129 9/32 (28%)
C2H2 Zn finger 434..454 CDD:275368 5/19 (26%)
C2H2 Zn finger 461..482 CDD:275368
C2H2 Zn finger 490..509 CDD:275368
lambda-1 491..>603 CDD:212564
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
ZSCAN32NP_001271456.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
SCAN 33..142 CDD:128708
SCAN 33..121 CDD:280241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..177
KRAB_A-box 218..250 CDD:295379
Myb_DNA-bind_4 253..334 CDD:290549
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..482 12/35 (34%)
COG5048 <455..668 CDD:227381 76/217 (35%)
zf-C2H2 522..543 CDD:278523 9/20 (45%)
C2H2 Zn finger 523..543 CDD:275368 9/19 (47%)
zf-H2C2_2 535..559 CDD:290200 13/23 (57%)
C2H2 Zn finger 551..571 CDD:275368 8/19 (42%)
zf-H2C2_2 563..588 CDD:290200 14/24 (58%)
C2H2 Zn finger 579..599 CDD:275368 8/19 (42%)
zf-H2C2_2 591..616 CDD:290200 10/24 (42%)
C2H2 Zn finger 607..627 CDD:275368 5/19 (26%)
zf-H2C2_2 623..644 CDD:290200 10/20 (50%)
C2H2 Zn finger 635..655 CDD:275368 6/19 (32%)
zf-H2C2_2 647..671 CDD:290200 6/23 (26%)
zf-C2H2 661..683 CDD:278523 5/21 (24%)
C2H2 Zn finger 663..683 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.