DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cg and zgc:165514

DIOPT Version :9

Sequence 1:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_001092705.1 Gene:zgc:165514 / 449909 ZFINID:ZDB-GENE-041008-169 Length:298 Species:Danio rerio


Alignment Length:273 Identity:98/273 - (35%)
Similarity:139/273 - (50%) Gaps:18/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 EDNEDSQGEAPNLKLEPGTLELSP------KTELQESMHFSETDATIKKERPYSCDECGKSFLLK 304
            |..||...|....:.:...|...|      :.:...:|| .:|.|   .|:||:|.||||||...
Zfish    25 EQREDLNEEKDKQRTKTTHLHSCPQCGKSFRRKANLNMH-RKTHA---GEKPYTCTECGKSFSQL 85

  Fly   305 HHLTTHARVHTGERPHICTHCGKSFAHKHCLNTHLLLHSTERPYQCQECKKSFTLKHHLLTHSRV 369
            ::...|.:.|..:|.|.|..|||||.....|..|.::|:.|:|::|..|:|||:...||..|.|:
Zfish    86 NNYKQHQKTHEDKRDHDCLQCGKSFTRAGGLKRHQMIHTGEKPHKCSYCEKSFSRSGHLRVHERI 150

  Fly   370 HSRERPFVCQECGRAFPLKRHLVTHSKFHAGERPYVCEECGESFAQENHLIMHSRFHGSLNPFVC 434
            |:.|:||.|.:||..|.|...|..|.:.|..|:||.|..|.:.|::..|...|.:.|......||
Zfish   151 HTGEKPFTCTQCGHDFRLSSDLKQHMRIHTNEKPYACLFCEKRFSRLAHCKQHQKTHTDERDHVC 215

  Fly   435 AECGASFPRKFQLVNHGRIH-GKIPHSCTVCGKEFLQKRTLVSHMRR---VHTGEQAHPCVSCGE 495
            :|||.||.|...|..|.||| |:.||.|:.|.|.|.:.    ||::|   :|||||.:.|..|.:
Zfish   216 SECGKSFIRVDHLKIHQRIHTGEKPHKCSYCEKSFCRS----SHLKRHEGIHTGEQRYCCPPCQK 276

  Fly   496 GFLTKAELHQHVR 508
            .|.....|..|::
Zfish   277 SFRRLENLLNHMK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cgNP_001097306.2 COG5048 287..>371 CDD:227381 34/83 (41%)
C2H2 Zn finger 294..314 CDD:275368 8/19 (42%)
zf-H2C2_2 306..331 CDD:290200 10/24 (42%)
C2H2 Zn finger 322..342 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 9/19 (47%)
zf-H2C2_2 362..385 CDD:290200 11/22 (50%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
zf-H2C2_2 390..415 CDD:290200 9/24 (38%)
C2H2 Zn finger 406..426 CDD:275368 5/19 (26%)
SIR2 <425..>465 CDD:294129 18/40 (45%)
C2H2 Zn finger 434..454 CDD:275368 10/19 (53%)
C2H2 Zn finger 461..482 CDD:275368 7/23 (30%)
C2H2 Zn finger 490..509 CDD:275368 5/19 (26%)
lambda-1 491..>603 CDD:212564 4/18 (22%)
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
zgc:165514NP_001092705.1 C2H2 Zn finger 47..67 CDD:275368 3/20 (15%)
zf-H2C2_2 59..84 CDD:290200 14/28 (50%)
COG5048 <71..259 CDD:227381 76/191 (40%)
C2H2 Zn finger 75..95 CDD:275368 8/19 (42%)
C2H2 Zn finger 103..123 CDD:275368 8/19 (42%)
zf-H2C2_2 116..140 CDD:290200 10/23 (43%)
C2H2 Zn finger 131..151 CDD:275368 9/19 (47%)
C2H2 Zn finger 159..179 CDD:275368 7/19 (37%)
zf-H2C2_2 171..196 CDD:290200 9/24 (38%)
C2H2 Zn finger 187..207 CDD:275368 5/19 (26%)
C2H2 Zn finger 215..235 CDD:275368 10/19 (53%)
zf-H2C2_2 227..250 CDD:290200 11/22 (50%)
C2H2 Zn finger 243..263 CDD:275368 7/23 (30%)
C2H2 Zn finger 271..289 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.